SecReT4
Protein ID: 10957315
T4SS name [ID]Tra_F [569]
Gene symbolR0126
Locus tagR27_p126
StrainSalmonella enterica subsp. enterica serovar Typhi plasmid R27 (NC_002305)
Repliconplasmid R27 [GenBank: NC_002305] [Browse all T4SS(s) in this replicon]
Location [Strand]110834..111880 [+]
Productputative pilus assembly and synthesis protein
Component typeTraF_F
UniProt IDQ9L5L6
KEGG IDsty:HCM1.264c
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.9e-49, Aligned region: 45..267
Thioredoxin_2 [PF13098], Evalue: 2.5e-07, Aligned region: 174..265
Protein Sequence: 348 a.a.     [Download]
>gi|10957315|ref|NP_058339.1| putative pilus assembly and synthesis protein [Salmonella enterica subsp. enterica serovar Typhi]
MTRLTLIPSKMLVLLSLFITGVHANEEQALIKDTPFVSGQAFKKGFFWYDDPTRKTEEEITETKPPVASS
TQPEQEEKIELNSKWLKDNMPQLLTKAMDNPTPENLSRFYTAQRLMLDIGTRFSDKSKDYFLKNPMMSEK
RRQPVEKVALDAHRTVVEKNQQSVMKDIFTKSGLFFFFQSTCQFCHEESQILQFMENYYSVDILPVSMDG
RPLQNGLFQDFSVPNAQIIDQFKIREVPTIFLVSKDGSSAQRISEGMITAEELKNTIILAAKGMKLIDDA
SFQSTLDIKRQYTIGEDGVITVNKSEMDSDPFLLQRIMDKKLEGYDMPTADPVNYLNVGGSLGGAYAR
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|10957190|ref|NC_002305.1|:110834-111880 Salmonella typhi plasmid R27, complete sequence
ATGACTCGATTAACGTTAATACCTTCAAAGATGTTAGTGCTGCTGTCTTTGTTTATTACTGGGGTCCATG
CAAATGAAGAGCAGGCCCTTATCAAAGACACTCCCTTTGTATCAGGACAGGCCTTCAAGAAAGGCTTTTT
CTGGTATGACGACCCGACAAGGAAAACTGAGGAAGAAATTACAGAGACCAAGCCTCCTGTTGCATCTTCG
ACCCAGCCAGAACAAGAAGAAAAGATTGAGCTTAATTCAAAGTGGCTAAAGGACAATATGCCTCAGCTTT
TGACTAAGGCTATGGATAATCCGACCCCTGAAAATTTATCGAGATTTTATACAGCACAACGTTTAATGCT
GGATATCGGTACGCGGTTTTCGGATAAATCGAAAGATTATTTCCTTAAAAATCCAATGATGTCTGAAAAA
CGCAGGCAACCGGTTGAAAAGGTAGCGCTCGATGCACATCGTACGGTGGTCGAGAAAAATCAGCAGTCGG
TTATGAAAGATATTTTCACTAAATCCGGGCTGTTTTTCTTTTTCCAGAGTACTTGTCAGTTCTGCCACGA
AGAAAGTCAAATACTCCAGTTTATGGAGAATTACTATTCTGTCGACATTCTTCCTGTCAGCATGGACGGC
AGACCACTACAGAATGGGTTGTTCCAGGATTTCTCTGTACCTAATGCGCAGATTATTGATCAATTTAAAA
TCCGTGAAGTTCCAACTATTTTCCTTGTCTCAAAAGATGGGTCATCAGCGCAACGAATAAGCGAAGGCAT
GATCACTGCTGAGGAGCTCAAGAATACTATTATTCTGGCTGCAAAAGGCATGAAGCTGATTGATGATGCC
TCTTTCCAGTCCACTTTAGATATTAAGCGCCAATATACCATTGGCGAGGATGGCGTAATTACTGTGAATA
AATCAGAAATGGACTCTGATCCGTTCTTATTGCAACGAATAATGGATAAGAAACTGGAAGGGTACGATAT
GCCAACGGCGGACCCAGTGAACTATCTGAATGTGGGTGGAAGTTTAGGAGGTGCATATGCGCGCTGA
 Primer design