SecReT4
Protein ID: 110346982
T4SS name [ID]VirB [197]
Gene symbol-
Locus tagMeso_4169
StrainChelativorans sp. BNC1
Repliconplasmid 1 [GenBank: NC_008242] [Browse all T4SS(s) in this replicon]
Location [Strand]67431..69467 [-]
ProductTRAG protein
Component typeVirD4
UniProt IDQ11N55
KEGG IDmes:Meso_4169
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2e-89, Aligned region: 111..534
TrwB_AAD_bind [PF10412], Evalue: 1.9e-30, Aligned region: 129..517
TraG-D_C [PF12696], Evalue: 1.3e-29, Aligned region: 382..503
Protein Sequence: 678 a.a.     [Download]
>gi|110346982|ref|YP_665800.1| TRAG protein [Chelativorans sp. BNC1]
MTGSLRIFYIGFCLIVALAVWLLAYGLGLQLLYGDGRILQAIITTDPFAPFQQLMAYGESSVLRTMALGS
LLPAALVACIVAYAGLRPNASPLGDARFQTVMSLRRDGWFRRKGKILGRFGRRILRVDDDRHHLIIGPTR
SGKGACYVIPNALAHEGSMIVTDLKGEIFRSTAGYRKLKGNQVFLFAPGSDKTHRYNPLDFIRPDRGDRT
TDIQNIAAILVPEVTESENSIWQATAQQVMAGVISYINESIYFKGHRNLGEVTAFFNSGTNLQALMTLLK
EREPYLSRFTIESFNAYIALSERAAASALLDIQKALRPFRNERVVAATSVTDMDLRALKRRPISIYLAPN
VTDITLLRPLLALFVQQTLDTLMLEHIERSVPVYFLLDEFRQLRKMSEITTKLPYVAGYNIKMAFVIQDL
KNLDEIYGETSRHSLMGNCGYQLVFGANDQVTAEAVSKGLGKRTVRYKTESRTIELMGLHRRTKVEQLRE
RDLMMPQEVRQMPGDKMVILAEGQNPIFADKLRFFRTAPFSEMERFSQANLPDVPATEFLPQRPMPATTS
GYAGEDTDLVESVQQKAEPDETAKLPRRRPLAAANARAGRSNRQVSASFTKEASPRAGGAVRTTPVKLDA
RFAMAARRLKTLAKAPAKPGSQRKASNWARVFDETVPDELELAEAEAS
 
Nucleotide Sequence: 2037 bp     [Download]
>gi|110346917|ref|NC_008242.1|:c69467-67431 Mesorhizobium sp. BNC1 plasmid 1, complete sequence
ATGACCGGATCGCTGCGTATCTTTTACATCGGCTTCTGCCTGATCGTCGCCCTTGCCGTCTGGCTGCTGG
CCTACGGACTCGGGTTGCAGTTGCTCTATGGCGACGGTCGGATCCTGCAGGCGATCATCACGACAGATCC
CTTCGCACCATTCCAGCAGCTCATGGCCTATGGGGAGAGCAGCGTCCTCCGCACGATGGCACTGGGCTCA
CTCCTTCCAGCTGCCCTCGTCGCCTGCATAGTCGCCTATGCGGGCCTTCGCCCGAACGCGAGCCCCCTCG
GCGATGCCCGCTTCCAGACGGTGATGTCGCTTCGGCGTGACGGATGGTTCAGGAGGAAAGGAAAGATACT
CGGCCGCTTCGGACGCCGGATTCTTCGCGTCGATGACGATCGGCATCACCTGATCATCGGTCCGACGCGC
TCGGGGAAGGGGGCCTGCTACGTCATTCCCAACGCGCTCGCTCATGAAGGCTCGATGATCGTTACTGACC
TCAAAGGGGAGATCTTCCGCAGCACCGCAGGCTACCGCAAATTGAAGGGCAACCAGGTCTTCCTATTCGC
GCCAGGGTCGGACAAGACCCACCGCTACAATCCCCTCGATTTCATCCGGCCGGACCGCGGCGATCGCACC
ACCGATATCCAGAACATCGCCGCGATCCTCGTCCCCGAGGTCACCGAGTCCGAGAATTCGATCTGGCAGG
CGACCGCGCAGCAGGTGATGGCCGGGGTGATCAGCTACATCAACGAAAGCATCTACTTCAAAGGACACCG
CAATCTCGGAGAGGTCACAGCCTTCTTCAACAGTGGCACCAATCTTCAGGCGCTCATGACCCTCCTCAAG
GAACGCGAGCCCTATCTGTCGCGGTTCACCATTGAGAGTTTCAACGCCTACATCGCTCTGTCCGAGCGTG
CGGCCGCATCCGCGCTGCTCGACATCCAGAAAGCGCTGCGGCCGTTCCGCAACGAGCGCGTGGTCGCGGC
GACGTCGGTGACCGACATGGACCTGCGCGCTCTGAAGCGTCGGCCGATTTCGATCTACCTCGCCCCCAAC
GTCACAGACATCACGCTGCTGCGACCGCTGCTGGCGCTGTTCGTGCAGCAGACCCTCGACACGCTCATGC
TTGAACATATCGAGCGTTCGGTGCCGGTCTATTTCCTCCTCGACGAGTTCCGGCAACTCAGGAAGATGAG
CGAGATCACGACAAAGCTGCCTTACGTCGCCGGCTACAACATCAAGATGGCTTTCGTGATCCAGGACCTC
AAGAACCTCGATGAAATCTACGGCGAGACGTCCCGCCATTCCCTGATGGGTAATTGCGGCTACCAGCTCG
TGTTTGGCGCCAACGATCAGGTTACCGCGGAAGCTGTCTCGAAAGGTCTGGGCAAGCGCACCGTCCGCTA
CAAGACCGAATCCCGCACGATCGAACTGATGGGCCTGCATCGCCGGACCAAGGTCGAGCAGTTGCGGGAG
CGCGACCTGATGATGCCGCAGGAAGTGCGACAGATGCCGGGAGACAAGATGGTCATCCTGGCCGAGGGGC
AGAACCCGATCTTCGCCGACAAGCTGCGGTTCTTCCGGACGGCGCCATTCAGTGAGATGGAAAGGTTCTC
CCAGGCAAACTTGCCAGATGTGCCGGCAACAGAGTTTCTGCCGCAACGGCCGATGCCGGCCACGACCTCC
GGATATGCCGGCGAAGACACCGATCTCGTAGAATCGGTCCAGCAGAAGGCCGAACCAGATGAGACGGCAA
AGCTTCCCCGCCGAAGGCCCTTGGCGGCGGCCAACGCACGGGCCGGCCGGAGCAATAGACAAGTGTCAGC
CTCTTTCACCAAGGAAGCGTCGCCGAGGGCGGGCGGTGCCGTGAGGACAACCCCAGTCAAGCTGGACGCG
CGCTTCGCAATGGCCGCCAGACGATTGAAGACGCTTGCGAAGGCGCCCGCTAAACCTGGGAGCCAACGCA
AGGCAAGCAATTGGGCCCGGGTTTTCGACGAGACGGTCCCTGACGAACTGGAGCTCGCTGAGGCCGAGGC
GAGCTGA
 Primer design