SecReT4
Protein ID: 110346983
T4SS name [ID]VirB [197]
Gene symbol-
Locus tagMeso_4170
StrainChelativorans sp. BNC1
Repliconplasmid 1 [GenBank: NC_008242] [Browse all T4SS(s) in this replicon]
Location [Strand]69464..70495 [-]
Producttype II secretion system protein E
Component typeVirB11
UniProt IDQ11N54
KEGG IDmes:Meso_4170
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.8e-83, Aligned region: 22..324
Protein Sequence: 343 a.a.     [Download]
>gi|110346983|ref|YP_665801.1| type II secretion system protein E [Chelativorans sp. BNC1]
MNVASPELASDNRHYFLYRALAPLKPFLDDRDVVEISVNRPGQVYVERLGAAHMAFHEIKELTTAEIVNI
GERVAASTNQFVSPANPILSAALPTGERIQVVLPPAAPDGGTLSIRKQVISNFTLEDYRDRGSLDQVTVA
VGGLSEIEQVLIEQLSAKDIYGFIRTAIVNRVSILISGGTSSGKTTFLNACLKSVDPHERIITLEDTREL
FPPQKNAVHLLASRGDQGTANVTIQSLLEASLRMRPDRLFVGEVRGSEAFAFLRAINTGHPGSMSTVHAD
TPLGAYEQLAMMVMQSGLSAAYPKADLISYIKQVIPIVIQLRREGGRRGVSEIFFARERMEVP
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|110346917|ref|NC_008242.1|:c70495-69464 Mesorhizobium sp. BNC1 plasmid 1, complete sequence
GTGAACGTGGCCTCCCCTGAGCTTGCGTCGGACAACCGGCACTACTTTCTTTATCGCGCGCTGGCGCCGC
TGAAACCGTTCCTTGACGATCGCGACGTCGTCGAGATTTCTGTCAATCGGCCGGGACAGGTCTATGTGGA
GCGCCTGGGCGCCGCGCACATGGCGTTTCATGAGATTAAGGAGCTCACCACGGCCGAGATCGTCAACATC
GGTGAGCGTGTGGCGGCCAGCACCAACCAGTTCGTCAGCCCAGCAAACCCAATTCTCAGCGCAGCACTAC
CCACCGGCGAGCGTATCCAAGTCGTCTTACCTCCAGCCGCCCCTGACGGCGGCACGCTGTCGATCCGCAA
GCAGGTCATCAGCAACTTCACGCTCGAGGATTATCGTGACAGGGGATCGCTCGACCAGGTGACGGTTGCC
GTCGGCGGCCTCAGCGAGATCGAGCAGGTGTTGATCGAGCAGCTCTCTGCCAAGGACATCTACGGCTTCA
TCCGCACAGCGATCGTCAATCGCGTGTCGATCCTGATCAGTGGCGGCACCTCGAGTGGAAAGACGACGTT
CCTCAACGCCTGCCTAAAATCCGTTGATCCCCATGAGCGTATCATCACGCTGGAAGACACGCGCGAGCTG
TTCCCGCCACAGAAAAATGCTGTTCACCTGCTTGCATCGCGTGGGGACCAGGGAACTGCCAATGTGACGA
TCCAGTCCTTGCTCGAGGCGTCGCTGCGCATGCGACCGGACCGCCTCTTCGTGGGCGAGGTGAGGGGATC
GGAGGCCTTCGCGTTCTTGCGCGCCATCAACACAGGTCATCCCGGGTCTATGTCTACGGTCCATGCCGAC
ACGCCGCTTGGTGCCTATGAGCAGCTCGCCATGATGGTCATGCAATCGGGTCTGTCGGCCGCCTACCCGA
AGGCGGATCTGATCTCCTACATCAAACAAGTCATCCCCATCGTGATCCAGTTGCGTAGGGAAGGGGGCCG
ACGCGGCGTCTCGGAAATCTTCTTCGCGCGCGAACGAATGGAAGTGCCATGA
 Primer design