SecReT4
Protein ID: 110346986
T4SS name [ID]VirB [197]
Gene symbol-
Locus tagMeso_4173
StrainChelativorans sp. BNC1
Repliconplasmid 1 [GenBank: NC_008242] [Browse all T4SS(s) in this replicon]
Location [Strand]72502..73197 [-]
ProductVirB8
Component typeVirB8
UniProt IDQ11N51
KEGG IDmes:Meso_4173
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.8e-63, Aligned region: 17..223
Protein Sequence: 231 a.a.     [Download]
>gi|110346986|ref|YP_665804.1| VirB8 [Chelativorans sp. BNC1]
MADKSETALRSYFQQGDIWEQEIIKRAKRSARVAWFFSIVFAGIALLSLLGVVLMLPLKSFEPYIVTVDR
TTGYIEVKSGLTRPANLTEQQAVTQANVVRYIRAREGYDPYAIEENFGIAALLSTDEAARELQALYSAAN
AQNPAKVYGRLKRVLVEIKSVTFPNTSTAIVRFSTNERSDTESIVRHWISVVRFRYTDTPMRNEWRFENP
LGFQVYSYRRDQETVTPGDAQ
 
Nucleotide Sequence: 696 bp     [Download]
>gi|110346917|ref|NC_008242.1|:c73197-72502 Mesorhizobium sp. BNC1 plasmid 1, complete sequence
ATGGCAGACAAGTCCGAAACCGCACTGCGGTCTTATTTCCAGCAGGGCGATATCTGGGAGCAGGAAATCA
TCAAGCGGGCGAAGCGCTCGGCGCGCGTAGCTTGGTTCTTCTCGATCGTCTTCGCCGGGATCGCCCTGCT
CAGCCTGCTCGGCGTGGTGTTGATGCTGCCGTTGAAAAGCTTCGAGCCGTATATCGTGACCGTCGACCGG
ACGACGGGCTACATCGAGGTGAAGTCGGGACTGACGCGGCCGGCCAACCTCACGGAGCAACAGGCTGTCA
CCCAGGCCAATGTGGTGCGCTATATCCGCGCCCGGGAAGGCTACGATCCCTATGCCATCGAGGAGAACTT
CGGGATCGCCGCACTGCTGTCCACAGACGAGGCAGCGCGCGAGTTGCAGGCGCTCTACAGCGCCGCCAAT
GCCCAGAACCCGGCGAAAGTTTACGGGCGCCTGAAACGGGTTCTGGTCGAGATCAAGTCGGTCACCTTCC
CCAATACCAGCACGGCGATCGTGCGATTCTCGACCAACGAACGCAGCGACACGGAATCGATCGTGCGTCA
TTGGATTTCGGTTGTCCGCTTTCGCTACACCGACACGCCGATGCGCAACGAGTGGCGCTTCGAGAATCCA
CTGGGCTTCCAGGTCTACTCGTATCGCCGCGACCAGGAGACTGTCACACCCGGGGACGCGCAATGA
 Primer design