SecReT4
Protein ID: 110347130
T4SS name [ID]VirB [198]
Gene symbol-
Locus tagMeso_4331
StrainChelativorans sp. BNC1
Repliconplasmid 1 [GenBank: NC_008242] [Browse all T4SS(s) in this replicon]
Location [Strand]230977..232896 [-]
Productconjugal transfer coupling protein TraG
Component typeVirD4
UniProt IDQ11MR8
KEGG IDmes:Meso_4331
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7.4e-99, Aligned region: 161..637
TraG-D_C [PF12696], Evalue: 1.2e-30, Aligned region: 473..597
TrwB_AAD_bind [PF10412], Evalue: 2.3e-22, Aligned region: 300..611
Protein Sequence: 639 a.a.     [Download]
>gi|110347130|ref|YP_665948.1| TRAG protein [Chelativorans sp. BNC1]
MAGKTKLKPALLWAIVPAVVTAMTLAITSYRWQAMAGGFSPANAYWFLRSAPVPNLLFGPIAGLITVFAL
PMHRRRPVAMVSLICFLGVAGFYALREYARLSPSVESGSVTWDEVLSYLDFFAVIAAAVGFVIVAISARI
SVVVSDPVKRAKRGTFGDADWLTMSAAAKLFPPDGEIVVGERYRVDKETIRDVPFDPADRETWGSGGTAP
LLTYKQDFDSTHMLFFAGSGGFKTTSNVVPTALRYTGPLICLDPSTEVAPMVVEHRTQSLGRECMVLDPT
NPVTGFNVLDWIETSKHKEEDIVAVAHMLLSESARFESSTGSYFQNQAHNLLTGLLAHVVLSPEYAGRRN
LRSLRQIVSEPEPSVLAMLRDIQETSASAFIRETLGVFTNMTEQTFSGVYSTASKDTQWLSLDDYAALVC
GRSFKSSDLVAGKRDVFLNIPAAILRSYPGIGRVIIGSLINAMTQADGAFQRRALFMLDEVDLLGYMRVL
EEARDRGRKYGITLMLMYQSVGQLERHFGKDGATSWIDGCAFASYAAIKALETARNVSAQCGEMTVEVEG
KSRNVGWSNSNSGSRRSESLNLQRRPLIMPHEITQQMRKDEQIIIVQGHDPIRCGRAIYFRRKDMDAQAS
PNRFVKSAV
 
Nucleotide Sequence: 1920 bp     [Download]
>gi|110346917|ref|NC_008242.1|:c232896-230977 Mesorhizobium sp. BNC1 plasmid 1, complete sequence
ATGGCGGGAAAGACGAAACTGAAGCCGGCGCTGTTATGGGCAATCGTGCCTGCCGTCGTGACAGCGATGA
CCCTGGCGATCACATCGTACAGATGGCAGGCAATGGCGGGCGGGTTCTCGCCTGCCAATGCCTATTGGTT
CTTACGCTCAGCACCCGTTCCCAATCTGCTCTTCGGTCCGATCGCGGGATTGATCACTGTCTTCGCGCTG
CCGATGCACCGCCGCCGGCCGGTGGCGATGGTCAGCCTGATCTGCTTTCTCGGGGTCGCCGGCTTTTACG
CTTTGCGCGAATATGCGCGGCTGTCCCCATCCGTCGAGAGCGGCTCGGTGACCTGGGACGAGGTGCTGTC
CTATCTCGACTTCTTCGCCGTCATTGCTGCGGCCGTCGGTTTCGTCATCGTCGCGATATCGGCGCGGATA
TCGGTCGTCGTGTCCGATCCGGTGAAGCGCGCCAAGCGCGGAACCTTCGGTGATGCCGATTGGCTCACCA
TGTCGGCCGCCGCAAAGCTGTTTCCGCCAGACGGCGAGATCGTCGTCGGCGAACGTTACCGCGTCGACAA
GGAAACGATCCGCGACGTGCCGTTCGATCCGGCCGACCGCGAGACATGGGGAAGCGGCGGCACCGCGCCG
CTGCTCACCTATAAGCAGGATTTCGATTCCACCCATATGCTGTTCTTTGCGGGCTCAGGCGGATTCAAGA
CCACCAGCAACGTGGTGCCGACGGCGCTGCGCTATACCGGGCCATTGATCTGCCTCGACCCGTCGACCGA
AGTCGCACCTATGGTCGTCGAGCACCGGACGCAATCGCTCGGGCGAGAGTGCATGGTCCTCGACCCGACA
AATCCAGTGACGGGGTTCAACGTTCTCGACTGGATCGAAACGTCAAAACACAAGGAGGAGGATATTGTCG
CGGTAGCCCACATGCTGCTGTCGGAAAGCGCGCGGTTCGAATCCTCGACCGGCAGCTATTTCCAGAACCA
GGCGCACAATCTTCTGACCGGATTGCTCGCCCATGTGGTGCTCTCTCCGGAATATGCCGGTCGGCGGAAC
CTGCGCAGTTTGCGCCAGATCGTCTCCGAGCCGGAACCGTCCGTGCTCGCCATGCTGCGCGACATTCAGG
AGACATCGGCGTCCGCCTTCATCCGCGAAACGCTCGGCGTCTTCACCAACATGACCGAGCAGACATTCTC
CGGCGTGTACTCCACGGCATCAAAGGATACGCAGTGGCTGTCGCTCGACGATTATGCCGCGCTTGTCTGC
GGCCGATCGTTCAAATCGAGCGATCTCGTCGCCGGAAAGAGGGACGTGTTCCTGAACATCCCTGCCGCCA
TCCTGCGCTCCTATCCGGGCATTGGCCGGGTGATCATCGGTTCCCTGATCAATGCCATGACACAGGCCGA
CGGCGCGTTTCAGCGCCGGGCCCTGTTCATGCTCGATGAAGTCGATTTGCTTGGCTATATGCGCGTTCTC
GAAGAGGCGCGCGATCGCGGTCGAAAATACGGCATCACGCTGATGCTCATGTACCAGTCGGTCGGCCAGC
TCGAACGGCATTTTGGCAAGGATGGCGCGACGTCATGGATCGATGGATGCGCCTTCGCCTCCTATGCCGC
GATCAAGGCGCTGGAGACCGCGCGGAACGTTTCGGCGCAATGCGGCGAGATGACCGTCGAGGTCGAGGGC
AAATCCCGCAATGTCGGGTGGAGTAATTCCAACAGCGGGTCGCGGCGCTCGGAAAGCCTCAACCTGCAAC
GCCGCCCTCTGATCATGCCGCACGAAATCACGCAGCAGATGCGCAAGGACGAGCAGATCATCATCGTACA
GGGCCACGACCCGATCCGCTGCGGGCGGGCGATCTACTTCCGGAGAAAGGACATGGATGCGCAGGCCAGT
CCGAACCGTTTCGTCAAGTCCGCCGTTTAG
 Primer design