SecReT4
Protein ID: 110347137
T4SS name [ID]VirB [198]
Gene symbol-
Locus tagMeso_4338
StrainChelativorans sp. BNC1
Repliconplasmid 1 [GenBank: NC_008242] [Browse all T4SS(s) in this replicon]
Location [Strand]241028..242062 [-]
Producttype II secretion system protein E
Component typeVirB11
UniProt IDQ11MR1
KEGG IDmes:Meso_4338
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.6e-81, Aligned region: 15..315
AAA_17 [PF13207], Evalue: 7.8e-05, Aligned region: 165..186
Protein Sequence: 344 a.a.     [Download]
>gi|110347137|ref|YP_665955.1| type II secretion system protein E [Chelativorans sp. BNC1]
MAENSDAGVVRQLLLPLDRFLKDESLYEVVINRPGEVLTEGTAGWKRHELPDLSFDKLMRLARAVASYSN
QGIDETRPLLSATLPDDERIQIVIPPATTRDTVSITIRKPSSVALSTADLEEGGLFENVVASADQTSRED
PLLASYRSGQYRVFLEGAVLARKNIIISGATGSGKTTISKALIQHIPDDERLISIEDTPELTIPQPNHVR
LFYSKGGQGLAKLGAKDLLESCLRMRPDRVLLQELRDGTAFYYIRNINSGHPGSITTVHADSPSLAFEQL
TLLVKESEGGQDLDREDIRNLLKISIDVIVQCKRVGGRFRVTEIYFADAIAPTARISSAGGVAP
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|110346917|ref|NC_008242.1|:c242062-241028 Mesorhizobium sp. BNC1 plasmid 1, complete sequence
ATGGCGGAAAACTCCGATGCTGGCGTCGTCCGCCAACTGCTTCTGCCGCTCGATCGCTTCTTGAAAGACG
AGAGCCTCTACGAGGTCGTCATCAATCGACCCGGCGAAGTGCTGACGGAAGGAACGGCTGGCTGGAAACG
CCACGAGCTGCCGGACCTGTCGTTTGACAAGCTGATGCGGCTGGCCCGCGCGGTGGCAAGTTACTCAAAT
CAGGGCATCGACGAGACGCGCCCGCTTCTCTCTGCCACCCTTCCGGACGACGAACGCATCCAGATTGTGA
TCCCGCCGGCGACGACACGCGACACCGTTTCCATCACCATCCGCAAGCCCTCATCTGTTGCGCTGTCCAC
GGCTGATCTGGAGGAGGGCGGCTTGTTCGAGAATGTCGTTGCGAGCGCCGATCAGACCTCTCGTGAAGAT
CCGTTGTTAGCGAGCTACCGCAGCGGACAGTATCGCGTCTTTCTCGAAGGTGCGGTTCTTGCGCGCAAGA
ACATCATCATCTCTGGCGCCACGGGATCCGGCAAGACCACGATCTCGAAGGCGCTAATCCAGCACATTCC
AGACGACGAACGGCTCATCAGCATCGAAGACACACCGGAGTTGACGATCCCGCAGCCGAACCATGTCCGG
CTGTTCTATTCCAAGGGCGGGCAGGGGCTGGCAAAGCTCGGCGCGAAGGATCTGCTTGAATCGTGCCTGC
GCATGCGCCCGGATCGGGTCCTCCTGCAGGAGCTGCGTGACGGCACTGCGTTCTACTACATCCGAAACAT
CAATTCCGGGCACCCCGGCTCGATCACCACCGTCCATGCGGATTCACCAAGCCTGGCGTTCGAGCAGTTG
ACACTCCTGGTCAAAGAATCCGAGGGGGGACAGGACCTCGACCGGGAAGACATCCGAAACCTGCTGAAGA
TTTCGATCGACGTGATCGTGCAGTGCAAGAGGGTCGGCGGCAGGTTCCGGGTGACGGAGATTTACTTCGC
TGACGCCATTGCCCCGACCGCCCGCATCTCTTCAGCTGGAGGGGTCGCGCCATAA
 Primer design