SecReT4
Protein ID: 110347140
T4SS name [ID]VirB [198]
Gene symbol-
Locus tagMeso_4341
StrainChelativorans sp. BNC1
Repliconplasmid 1 [GenBank: NC_008242] [Browse all T4SS(s) in this replicon]
Location [Strand]244108..244779 [-]
ProductVirB8
Component typeVirB8
UniProt IDQ11MQ8
KEGG IDmes:Meso_4341
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.1e-66, Aligned region: 13..220
Protein Sequence: 223 a.a.     [Download]
>gi|110347140|ref|YP_665958.1| VirB8 [Chelativorans sp. BNC1]
MVTTDSLKEYFDKARRFDQDRMVSAERSKRLAWFVAIVASVLACVSVAAVVALTPLKTVEPFVIRVDNST
GIVDVVSAMASTAGNYDEEVTKYFAARYVRAREGYVWSEAEENFRTASLMSNAAEQQRFAAAYRGGNPES
PQNVYGRSATSRIGIKSISLINSNVVSVRYTRTITRGEDVRTTHWVATITYSYANAPISSSDRLVNPLGF
VVSEYRADPEALN
 
Nucleotide Sequence: 672 bp     [Download]
>gi|110346917|ref|NC_008242.1|:c244779-244108 Mesorhizobium sp. BNC1 plasmid 1, complete sequence
ATGGTGACGACAGACAGTCTCAAGGAATATTTCGACAAGGCGCGCCGCTTCGATCAGGACCGGATGGTCT
CCGCCGAGCGCTCAAAACGACTCGCCTGGTTCGTCGCCATCGTCGCCAGCGTGCTGGCCTGCGTCTCGGT
TGCCGCCGTGGTCGCGCTGACGCCGCTCAAGACGGTCGAACCCTTTGTCATCCGCGTCGACAATTCGACC
GGCATCGTCGACGTCGTGTCAGCCATGGCGTCGACCGCCGGCAACTATGACGAGGAGGTCACCAAATATT
TCGCCGCCCGTTACGTCCGGGCACGCGAAGGCTATGTCTGGTCGGAAGCGGAAGAGAATTTCCGGACCGC
ATCGCTGATGTCGAACGCGGCTGAGCAGCAGCGCTTTGCGGCCGCGTATCGCGGCGGCAATCCGGAATCT
CCGCAGAATGTCTATGGGCGCTCGGCGACGTCCCGTATCGGGATCAAGTCAATCTCACTCATCAACAGCA
ATGTCGTTTCAGTCCGCTACACGCGGACAATCACACGCGGCGAAGATGTCCGCACAACCCATTGGGTGGC
AACGATCACCTATTCCTATGCCAATGCCCCAATATCCTCCAGCGACCGGTTGGTGAACCCGCTTGGGTTC
GTGGTGAGCGAGTACCGGGCCGATCCGGAGGCCTTGAATTGA
 Primer design