SecReT4
Protein ID: 110347141
T4SS name [ID]VirB [198]
Gene symbol-
Locus tagMeso_4342
StrainChelativorans sp. BNC1
Repliconplasmid 1 [GenBank: NC_008242] [Browse all T4SS(s) in this replicon]
Location [Strand]244785..245075 [-]
Productputative type IV secretion system protein VirB7
Component typeVirB7
UniProt IDQ11MQ7
KEGG IDmes:Meso_4342
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 96 a.a.     [Download]
>gi|110347141|ref|YP_665959.1| putative type IV secretion system protein VirB7 [Chelativorans sp. BNC1]
MHIVRVVTMMGLLAAVSGCATLSYPLPKCDGYAKRPLNRSMWDWDAGKAQGNPQQQSSRAGGDALALAFA
EHEPTVATVAFAGFDEAGSHAACRAG
 
Nucleotide Sequence: 291 bp     [Download]
>gi|110346917|ref|NC_008242.1|:c245075-244785 Mesorhizobium sp. BNC1 plasmid 1, complete sequence
GTGCATATAGTTCGAGTTGTAACAATGATGGGGCTGCTGGCGGCGGTCTCCGGCTGCGCGACGCTAAGTT
ACCCGCTGCCCAAATGCGACGGTTACGCGAAGCGTCCGCTCAATCGTTCGATGTGGGATTGGGATGCCGG
GAAAGCACAGGGCAATCCGCAACAGCAATCCTCGCGCGCTGGTGGCGACGCGTTAGCCTTGGCGTTCGCC
GAGCATGAACCAACCGTCGCGACCGTAGCCTTCGCCGGATTCGACGAAGCCGGCTCTCACGCCGCTTGCC
GGGCAGGGTAG
 Primer design