SecReT4
Protein ID: 110632860
T4SS name [ID]Trb [269]
Gene symbol-
Locus tagMeso_0500
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]554206..555405 [-]
Productconjugation TrbI-like protein
Component typeTrbI
UniProt IDQ11L22
KEGG IDmes:Meso_0500
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 4.6e-59, Aligned region: 215..393
Protein Sequence: 399 a.a.     [Download]
>gi|110632860|ref|YP_673068.1| conjugation TrbI-like protein [Chelativorans sp. BNC1]
MSERDTPNEADAPLVGTPPDDAAAPMRLRAEPPRVTRLSRKVLGGISLVAALGVGGALIYALQTRSIGPG
SEELYSTQNRRTADGLAGLPRDYTGPVLGPPLPGDLGRPILDAQNRGQPVTPPMAAAPTVDPVEQRRRAE
EEAALTSRVFFQTEARVAAPIATAGGPGSPSLSGLGLPGQPGAATAQDRQLAFLNAGVDRRTVSPDRVMG
PASPYVLQTGAVIAAALITGIRSDLPGQITAQVTEHVYDSPTGRILLVPQGTRLIGEYSNDVGFGQRRVL
LVWKRLILPNGRSIVLERQPGADAQGYAGLQDGVDYHWWDLAKAAGLSTLLSVGAELAVDDQDRLLRAIR
NGGQDTINDAGQQIIRRQLNVAPTLTIRPGFPVRVIVTRDLVLEPYGGL
 
Nucleotide Sequence: 1200 bp     [Download]
>gi|110632362|ref|NC_008254.1|:c555405-554206 Chelativorans sp. BNC1 chromosome, complete genome
ATGAGCGAGCGCGACACGCCCAACGAAGCCGACGCACCGCTGGTCGGCACACCGCCCGACGATGCCGCTG
CGCCCATGCGGCTGCGCGCCGAACCGCCCCGGGTCACCCGACTGTCGCGAAAGGTGCTGGGCGGTATCAG
TCTCGTCGCCGCCCTCGGGGTCGGTGGCGCGCTCATCTATGCGCTTCAGACGCGCAGTATCGGCCCTGGC
AGTGAGGAGCTTTACTCCACGCAAAATCGGCGAACCGCGGACGGGCTTGCCGGCCTGCCACGCGACTACA
CCGGCCCGGTGCTCGGGCCTCCGCTGCCCGGAGATCTGGGGCGACCCATCCTCGATGCGCAGAATCGTGG
CCAGCCCGTCACGCCGCCGATGGCGGCAGCGCCCACCGTCGATCCGGTTGAGCAGCGCAGGCGCGCGGAA
GAAGAAGCTGCCCTAACGAGCCGCGTCTTCTTTCAGACGGAGGCGCGCGTCGCAGCTCCGATTGCGACAG
CTGGCGGACCAGGCAGCCCGAGCCTCTCTGGGCTAGGTCTTCCGGGCCAGCCGGGGGCAGCGACGGCGCA
GGATCGCCAGCTCGCGTTCCTGAATGCGGGCGTGGACCGCCGCACGGTCTCGCCAGATCGCGTGATGGGT
CCGGCGTCGCCCTATGTGCTTCAGACCGGCGCCGTCATCGCCGCGGCCCTCATCACCGGCATCCGATCCG
ACCTGCCGGGCCAGATCACTGCGCAGGTCACGGAGCATGTCTACGACAGCCCGACCGGGCGCATCCTGCT
CGTCCCACAGGGCACGCGGCTGATCGGCGAGTACAGCAACGATGTCGGCTTCGGTCAGCGCCGGGTGCTG
CTCGTCTGGAAGCGGCTCATCCTCCCGAATGGCCGTTCGATCGTCCTGGAACGTCAACCCGGAGCCGACG
CGCAAGGCTATGCGGGTCTCCAGGATGGCGTCGACTATCACTGGTGGGATCTCGCCAAGGCTGCCGGCCT
GTCGACACTGCTGTCGGTCGGCGCCGAACTCGCCGTTGACGATCAGGATCGGCTGCTCCGGGCGATCCGC
AACGGCGGGCAGGACACCATCAACGATGCAGGGCAGCAGATCATCCGTCGGCAACTCAATGTCGCGCCGA
CCCTGACGATCAGACCGGGGTTCCCCGTGCGCGTCATCGTCACCCGCGACCTCGTGCTCGAACCTTATGG
AGGGTTGTGA
 Primer design