SecReT4
Protein ID: 110632861
T4SS name [ID]Trb [269]
Gene symbol-
Locus tagMeso_0501
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]555402..556382 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDQ11L21
KEGG IDmes:Meso_0501
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.1e-62, Aligned region: 103..319
Protein Sequence: 326 a.a.     [Download]
>gi|110632861|ref|YP_673069.1| conjugal transfer protein TrbG/VirB9/CagX [Chelativorans sp. BNC1]
MRDHLRRSASRSFRLSGSALLLISGLALAGCATNRPPQVSYDADVPPLPPVPAAVTEAPPRPLHTPPAWT
PARGGAAAGTPAGRVENANAAARVEPRREGYYNSIQIYPWSEGALYQVYAAPGQITNIALEPGESLTGAG
PIAAGDTARWIIGDTESGSGITRRVHVLVKPTRPDITTNLVITTDRRIYMIELRSGERPYMPAVAWAYPQ
PPASQRQAVPATPVLPAVAARNYRYGLTGDTPPWRPISVYDDGRRVYVEFPRGIVQGEMPPLFVIGADGE
PQIANSRIHQNILIVDRLFGAAELRLGSGERQQTVRIVRTDGRPAS
 
Nucleotide Sequence: 981 bp     [Download]
>gi|110632362|ref|NC_008254.1|:c556382-555402 Chelativorans sp. BNC1 chromosome, complete genome
ATGAGAGATCATCTCCGCCGATCCGCGAGCCGCAGCTTCCGTCTATCCGGCTCTGCGCTTTTGCTGATCT
CCGGATTGGCGCTGGCCGGCTGCGCGACCAACCGGCCGCCACAGGTCAGCTACGACGCCGATGTGCCGCC
GCTTCCCCCTGTGCCGGCTGCCGTCACGGAGGCGCCACCAAGGCCGCTTCACACACCGCCCGCCTGGACA
CCCGCGCGCGGTGGCGCTGCCGCAGGGACGCCGGCGGGCCGCGTGGAGAATGCCAACGCCGCCGCGCGCG
TCGAACCACGCCGCGAGGGGTATTACAACTCGATCCAGATCTATCCCTGGAGCGAGGGCGCGCTCTATCA
GGTCTATGCCGCTCCCGGGCAGATCACCAACATCGCGCTGGAACCAGGCGAGAGCCTGACCGGCGCCGGC
CCGATCGCTGCGGGCGACACAGCGCGCTGGATCATCGGCGACACCGAGAGCGGCTCGGGGATCACTCGCC
GCGTCCATGTTCTCGTGAAGCCGACACGGCCAGATATCACGACCAATCTGGTCATCACCACCGACCGTCG
CATCTACATGATCGAGCTGCGCTCGGGCGAACGCCCTTATATGCCGGCCGTCGCTTGGGCCTATCCCCAG
CCGCCCGCCTCGCAGAGACAGGCAGTGCCCGCTACGCCAGTGCTCCCGGCCGTTGCGGCACGGAACTATC
GCTACGGCCTCACGGGCGACACGCCGCCGTGGCGGCCAATCTCGGTCTACGACGACGGGCGCCGCGTCTA
TGTCGAGTTCCCGCGTGGGATCGTTCAGGGCGAGATGCCGCCGCTCTTCGTCATCGGCGCAGATGGCGAA
CCGCAGATCGCCAACAGCAGGATCCACCAGAACATACTGATCGTCGACCGCCTGTTCGGCGCCGCCGAGC
TCCGTCTCGGCAGTGGCGAGCGCCAGCAGACGGTCCGGATCGTTCGCACCGATGGGAGGCCCGCGTCATG
A
 Primer design