SecReT4
Protein ID: 110632862
T4SS name [ID]Trb [269]
Gene symbol-
Locus tagMeso_0502
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]556379..557068 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ11L20
KEGG IDmes:Meso_0502
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.6e-62, Aligned region: 23..226
Protein Sequence: 229 a.a.     [Download]
>gi|110632862|ref|YP_673070.1| conjugal transfer protein TrbF [Chelativorans sp. BNC1]
MSFFKRPATHYGKTPGPETPYQRAAQIWDDRIGSARVQARNWRLMAFGCLILSAGFAAALVWQSARGTIV
PWVVQVDNLGQAQAVAPAQADYRPTDPQVAWHLARFIEQVRSIPADAIVVRQNWLRAYEFTTDRGAAALN
DFARANDPFTRVGKQQVSIEVSSVIRASPDSFRVAWTERQYENGQLSTTQRWTAILTIVIQPPRDAERLR
ANPLGIYVNAINWSREMGQ
 
Nucleotide Sequence: 690 bp     [Download]
>gi|110632362|ref|NC_008254.1|:c557068-556379 Chelativorans sp. BNC1 chromosome, complete genome
ATGAGCTTCTTCAAGCGACCCGCAACCCACTATGGAAAGACGCCCGGGCCCGAGACGCCGTATCAGCGCG
CGGCGCAGATCTGGGATGATCGAATCGGCTCAGCGCGTGTCCAGGCCCGAAACTGGCGGCTCATGGCCTT
CGGCTGCCTGATCCTCTCCGCCGGCTTCGCTGCCGCGCTGGTCTGGCAGTCGGCGCGCGGGACCATCGTC
CCGTGGGTGGTGCAGGTCGACAATCTCGGCCAGGCGCAGGCGGTCGCGCCAGCGCAGGCCGACTACCGCC
CCACCGACCCGCAGGTGGCCTGGCATCTGGCGCGGTTCATCGAGCAGGTCCGCTCGATCCCGGCCGACGC
CATCGTCGTGCGGCAGAATTGGCTGCGCGCCTACGAGTTCACGACCGATCGCGGCGCGGCGGCCCTCAAT
GACTTCGCCCGCGCCAACGATCCGTTCACCCGCGTCGGGAAGCAGCAGGTGTCGATCGAAGTGTCGAGCG
TTATCCGCGCGTCGCCTGACAGCTTCCGCGTCGCCTGGACCGAACGCCAATACGAGAACGGCCAGCTCTC
CACGACACAACGCTGGACAGCCATCCTGACCATCGTGATCCAACCCCCACGCGACGCAGAGCGGCTGCGG
GCCAATCCGCTCGGAATCTACGTCAACGCCATCAACTGGTCTCGGGAGATGGGGCAATGA
 Primer design