SecReT4
Protein ID: 110632863
T4SS name [ID]Trb [269]
Gene symbol-
Locus tagMeso_0503
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]557065..558414 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ11L19
KEGG IDmes:Meso_0503
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.8e-53, Aligned region: 37..262
Protein Sequence: 449 a.a.     [Download]
>gi|110632863|ref|YP_673071.1| conjugal transfer protein TrbL [Chelativorans sp. BNC1]
MGGSGVIDNFLGVFTSYIDSGFGLLGGEVAFIATTLIVIDVTLAALFWSWGADGDIIARLVKKTLFVGVF
AYIIGNWNNLARIVFESFAGLGLQASGTGFSIQDLMRPGRVAQTGLDAARPLLESISNLMGWIAFFENFI
QIACLLFAWALVLLAFFILAIQLFITLIEFKLTTLAGFVLIPFGLFGKTAFMAERVLGNVISSGIKVLVL
AVIIGIGSTLFSQFTAGFGGQPPTIDDAMAVVLAALSLLGLGIFGPGIANGIVSGGPQLGAGSAIGTGLV
AGGAAMAAGGAAGLALRGGASAISGGAAAMRGGATAAGAASAAYSLGSLGQSGAAGVASGLGGVARAAGG
AAASPLRRAAQSVRSSFADGVKSGFGATGGSSSMGTVANDAGSAAPAATGSAASPPAWAQRMRRGQTMSH
GVTLAAHAIRSGDSHGGGSSINLSGGDRT
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|110632362|ref|NC_008254.1|:c558414-557065 Chelativorans sp. BNC1 chromosome, complete genome
ATGGGCGGCAGCGGCGTCATCGACAATTTCCTCGGGGTCTTCACCTCCTACATCGACAGCGGATTCGGCC
TGCTCGGCGGCGAGGTGGCGTTCATCGCGACGACGCTGATCGTCATCGACGTCACGCTGGCCGCCCTGTT
CTGGAGCTGGGGCGCGGACGGCGACATCATCGCACGCCTTGTGAAGAAGACGCTGTTTGTGGGCGTCTTC
GCCTACATCATCGGCAACTGGAACAACCTCGCGCGGATCGTCTTCGAAAGCTTCGCCGGCCTCGGACTTC
AGGCGTCTGGCACCGGGTTTTCCATCCAGGACCTGATGCGCCCGGGCCGGGTCGCGCAGACGGGTCTCGA
TGCGGCGAGGCCGCTGCTCGAATCCATCTCAAACCTGATGGGCTGGATCGCCTTCTTCGAAAACTTCATC
CAGATCGCCTGCCTGCTCTTCGCCTGGGCGCTGGTGCTGCTCGCCTTCTTCATCCTCGCCATCCAGCTCT
TCATCACGCTGATCGAATTCAAGCTGACCACCCTGGCCGGCTTTGTCCTGATCCCGTTCGGCCTGTTCGG
GAAGACCGCCTTCATGGCCGAGCGCGTGCTGGGAAACGTCATCTCGTCAGGGATCAAGGTACTGGTGCTC
GCCGTCATCATCGGCATCGGCTCGACTCTGTTCAGTCAGTTCACGGCAGGATTCGGCGGTCAGCCACCGA
CCATCGACGACGCGATGGCCGTCGTATTGGCGGCGCTGTCGCTTCTCGGTCTCGGCATATTCGGTCCGGG
TATCGCCAACGGCATCGTTTCCGGCGGCCCGCAACTCGGCGCAGGCTCCGCCATCGGCACCGGCCTCGTC
GCGGGCGGCGCAGCCATGGCTGCCGGCGGCGCGGCCGGGCTCGCCCTGCGCGGTGGCGCGAGCGCCATTT
CCGGCGGCGCCGCCGCCATGCGCGGTGGAGCCACCGCGGCGGGAGCCGCCTCTGCTGCCTACAGTCTCGG
TTCCCTCGGCCAGTCGGGCGCTGCCGGCGTCGCGTCGGGCCTCGGCGGCGTCGCACGAGCGGCCGGCGGC
GCGGCAGCCTCTCCGCTGCGCCGGGCCGCGCAAAGCGTTCGCTCGAGCTTCGCCGACGGCGTCAAAAGCG
GCTTCGGAGCCACCGGCGGTTCCTCGAGCATGGGAACGGTCGCGAATGATGCCGGTTCGGCCGCACCGGC
AGCCACAGGCTCTGCCGCCAGCCCGCCGGCTTGGGCGCAGCGCATGCGACGTGGGCAGACCATGAGCCAC
GGCGTCACGCTCGCGGCACACGCGATCCGATCGGGCGACAGCCACGGCGGCGGCTCTTCCATCAATCTCT
CCGGAGGCGACCGCACATGA
 Primer design