SecReT4
Protein ID: 110632865
T4SS name [ID]Trb [269]
Gene symbol-
Locus tagMeso_0505
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]558710..559471 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ11L17
KEGG IDmes:Meso_0505
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 3e-08, Aligned region: 15..51
Protein Sequence: 253 a.a.     [Download]
>gi|110632865|ref|YP_673073.1| conjugal transfer protein TrbJ [Chelativorans sp. BNC1]
MMIRRSRAALFAATILSLPVAFSPVFVTPAAAQWVVYDPTNYVQNVLSAARALERINNQIQSLQNEAQML
INQARNLASLPYSSLQQLQQSVQRTQALLGQAQRIAFDVQQIDQAFQSQYSNISLSTSDQRLVSDARSRW
QNTVGGLQDALRVQAGVVGNIDTNRAEMAALVGQSQGATGALQATQAGNQLLALQAQQLADLVAVVAANG
RAQALVDAERAAAAEQGREQRRRFLTPGSGYQPGNARMFPNGN
 
Nucleotide Sequence: 762 bp     [Download]
>gi|110632362|ref|NC_008254.1|:c559471-558710 Chelativorans sp. BNC1 chromosome, complete genome
ATGATGATCCGACGCTCTCGCGCGGCGCTGTTCGCCGCAACCATCCTGTCGCTGCCCGTCGCCTTCTCGC
CCGTGTTCGTGACCCCGGCAGCGGCGCAGTGGGTCGTTTATGATCCGACCAACTACGTCCAGAATGTCCT
ATCGGCCGCGCGGGCGCTCGAGCGGATCAACAACCAGATCCAGAGCCTCCAGAACGAAGCGCAGATGCTG
ATCAACCAGGCCCGCAATCTCGCGAGCCTGCCCTATTCCTCGCTTCAGCAGCTCCAGCAATCGGTGCAGC
GCACGCAAGCGCTTCTGGGTCAGGCACAGCGCATCGCCTTCGACGTGCAGCAGATCGACCAAGCCTTTCA
GAGCCAGTACAGCAACATCTCGCTGTCCACTTCGGATCAGCGTCTCGTCTCCGATGCACGATCGCGCTGG
CAGAACACGGTCGGCGGCCTTCAGGACGCGCTGCGCGTGCAGGCCGGTGTCGTCGGCAATATCGACACCA
ACCGCGCCGAGATGGCGGCTCTGGTCGGGCAGAGCCAGGGTGCGACCGGCGCGCTTCAGGCAACCCAGGC
CGGCAACCAGTTGCTCGCATTGCAGGCGCAGCAACTCGCAGACCTGGTCGCTGTGGTCGCTGCGAACGGC
CGAGCGCAGGCGCTTGTCGATGCCGAGCGAGCCGCAGCCGCCGAACAAGGCCGTGAACAGCGCCGCCGGT
TCTTGACGCCCGGCTCCGGCTATCAGCCCGGCAACGCCCGGATGTTCCCGAACGGCAACTGA
 Primer design