SecReT4
Protein ID: 110632866
T4SS name [ID]Trb [269]
Gene symbol-
Locus tagMeso_0506
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]559468..561906 [-]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDQ11L16
KEGG IDmes:Meso_0506
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.5e-33, Aligned region: 442..723
CagE_TrbE_VirB [PF03135], Evalue: 3.7e-13, Aligned region: 181..388
Protein Sequence: 812 a.a.     [Download]
>gi|110632866|ref|YP_673074.1| conjugal transfer ATPase TrbE [Chelativorans sp. BNC1]
MMNLAEYRRTATRLADFLPWAALVGEGVVLNKDGSFQRTARFRGPDLDSAVAAELVAVASRLNNAFRRLG
SGWAIFVEAQRHEAASYPASRFADAASALVDAERKADFEEADAHYESSYFLTFLYLPPAEDAARAETWLY
EGRQQSGVDPHEALAAFIDRTNRVLQLVDGFMPECRWLDDAETLTYLHSTVSTKRHRVRVPETPIYLDAL
LAVEPLTGGLEPRLGAAHLRVLTINGFPTATTPGILDDLNRLAFPYRWSTRAILLDKTDATKLLTRIRRQ
WFAKRKSIAAILKEVMTNEASALVDTDAANKAADADMALQELGADYAGQAYVTATVTVWDADPRTADEKL
RLVEKVIQGRDFTAMSETINAVDAWLGSLPGHVYANVRQPPISTLNLAHMIPLSAVWAGPERDEHFGAPP
LLYGKTEGSTPFRFSLHVGDVGHTLVVGPTGAGKSVLLALIALQFRRYPGSQVFAFDFGGSIRAAALAMG
GDWHDLGGSLTDGAASSVSLQPLARVHETHERAWAADWIAAILARESVTITPEVKEHLWTALTSLASAPI
TERTLTGLAVLLQSNDLKQALRPFCVGGAYGRLLDAEGEQLGEAAVQAFETEGLIGGGAAPAVLAYLFHR
IGDRLDGRPTLLIVDEGWLALDDEGFAAQLREWLKTLRKKNASVVFATQSLADIDGSAIAPAIIESCQTR
LLLPNERAIEPQITTIYRRFGLNDRQIEILSRATPKRDYYCQSRRGNRLFELGLSEVALALCAASSKTDQ
AAIEAILAEHGRDGFLSAWLRARDVGWAADLIPDLTNLEPKP
 
Nucleotide Sequence: 2439 bp     [Download]
>gi|110632362|ref|NC_008254.1|:c561906-559468 Chelativorans sp. BNC1 chromosome, complete genome
ATGATGAACCTCGCCGAATATCGCCGAACCGCGACCCGCCTTGCAGATTTCCTGCCCTGGGCGGCGCTGG
TCGGCGAAGGGGTCGTGCTGAACAAGGACGGCAGCTTCCAGCGCACCGCGCGCTTTCGTGGTCCCGATCT
CGACTCTGCTGTGGCCGCCGAACTGGTGGCAGTCGCCAGTCGCCTCAACAACGCCTTCCGGCGTCTGGGC
TCGGGCTGGGCGATCTTCGTCGAAGCGCAGCGCCACGAAGCCGCCTCCTATCCGGCAAGCCGCTTCGCGG
ACGCCGCCTCCGCCCTCGTTGATGCGGAGCGCAAGGCCGACTTCGAGGAAGCGGACGCGCATTACGAGTC
GAGCTACTTCTTGACCTTTCTCTATCTCCCGCCTGCCGAGGACGCCGCGCGGGCGGAAACCTGGCTCTAC
GAGGGTCGCCAACAGTCCGGCGTCGATCCCCATGAAGCCCTCGCGGCCTTCATTGACCGCACAAACCGCG
TCCTCCAGCTCGTCGATGGCTTCATGCCGGAATGCCGGTGGCTCGATGACGCCGAGACCCTGACTTACCT
GCACTCGACCGTCTCGACGAAGCGCCACCGCGTCCGCGTGCCCGAAACGCCGATCTACCTCGATGCGCTT
CTCGCCGTTGAGCCGTTGACCGGCGGCCTCGAGCCACGGCTCGGCGCCGCTCATCTGCGCGTGCTGACGA
TCAACGGCTTTCCGACGGCGACGACGCCAGGGATTCTCGACGATCTCAACCGGCTCGCCTTTCCCTATCG
CTGGTCCACGCGGGCGATCCTCCTCGACAAGACGGACGCCACGAAACTGCTGACGCGCATCCGGCGGCAG
TGGTTCGCCAAGCGCAAGTCGATCGCCGCAATCCTGAAGGAGGTAATGACCAACGAGGCCTCCGCACTCG
TCGATACGGACGCTGCGAACAAGGCCGCCGATGCCGACATGGCCCTGCAGGAGCTTGGGGCCGACTATGC
CGGTCAGGCCTATGTGACCGCCACGGTCACAGTCTGGGACGCCGATCCGCGCACCGCCGACGAGAAGTTG
CGCCTCGTGGAAAAGGTGATCCAGGGCCGCGACTTCACCGCGATGTCCGAGACCATCAATGCCGTCGATG
CCTGGCTCGGTTCGCTGCCCGGCCATGTCTACGCCAACGTCCGCCAGCCACCGATCTCCACTCTAAACCT
CGCCCACATGATTCCGCTCTCGGCGGTCTGGGCCGGGCCGGAACGGGACGAGCATTTCGGAGCGCCGCCG
CTGCTGTACGGCAAGACCGAAGGGAGCACGCCGTTCCGCTTTTCGCTGCATGTCGGCGACGTCGGCCACA
CACTGGTCGTCGGGCCGACAGGCGCGGGCAAGTCCGTGCTGCTCGCGCTCATCGCACTTCAGTTCCGGCG
CTATCCGGGCAGCCAAGTCTTCGCCTTCGACTTCGGCGGCTCCATTCGCGCGGCCGCGCTCGCCATGGGA
GGCGATTGGCACGACCTCGGTGGCAGCCTGACGGACGGCGCCGCGTCGTCGGTCTCCCTCCAGCCACTCG
CACGCGTTCACGAGACCCATGAGCGTGCCTGGGCAGCCGACTGGATTGCCGCCATCCTTGCCCGCGAGAG
CGTCACGATCACGCCGGAAGTGAAAGAACATCTCTGGACGGCGCTGACCTCGCTGGCGTCCGCGCCGATC
ACAGAGCGCACGCTGACGGGCCTCGCCGTCCTCCTCCAGTCGAACGATCTCAAGCAAGCGCTGCGCCCCT
TTTGCGTCGGCGGTGCCTACGGACGGCTGCTGGACGCCGAAGGCGAGCAGCTAGGGGAAGCTGCGGTCCA
GGCCTTTGAAACCGAGGGGCTGATCGGCGGCGGCGCGGCGCCGGCGGTCCTCGCCTATCTCTTCCATCGG
ATCGGCGACCGTCTGGATGGACGGCCCACGCTCCTGATCGTCGACGAAGGCTGGCTCGCGCTCGACGATG
AAGGCTTCGCGGCGCAACTGCGCGAATGGCTGAAGACGCTGCGCAAGAAGAACGCGTCGGTCGTCTTCGC
CACGCAATCGCTGGCCGACATCGATGGGAGCGCGATCGCTCCGGCCATCATCGAAAGCTGCCAGACGCGC
CTTTTGCTGCCGAACGAACGCGCGATCGAACCCCAGATCACCACGATCTACCGGCGCTTCGGCTTGAACG
ACCGCCAGATCGAGATCCTCAGCCGGGCCACACCCAAGCGCGACTATTACTGCCAGTCGCGGCGCGGCAA
CCGGCTATTCGAGTTGGGGCTCTCCGAAGTCGCCCTCGCGCTCTGCGCGGCATCCTCGAAAACTGATCAG
GCCGCCATCGAGGCGATCCTCGCCGAGCATGGCCGCGACGGCTTCCTGTCCGCCTGGCTGCGCGCCCGCG
ATGTCGGATGGGCCGCCGACCTCATTCCCGATCTCACCAACCTGGAGCCCAAGCCATGA
 Primer design