SecReT4
Protein ID: 110632867
T4SS name [ID]Trb [269]
Gene symbol-
Locus tagMeso_0507
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]561916..562197 [-]
Productconjugal transfer protein trbB
Component typeTrbD
UniProt IDQ11L15
KEGG IDmes:Meso_0507
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 4.6e-10, Aligned region: 16..84
Protein Sequence: 93 a.a.     [Download]
>gi|110632867|ref|YP_673075.1| conjugal transfer protein trbB [Chelativorans sp. BNC1]
MAGLLHHPDEVAGFSVPVHRALTEQILLGGAPRSIAIMNGTLAGAVGLGLRLWLVGLLIWAIGHFAAVWA
AKRDPLFVEVGRRHLRIPGHLSV
 
Nucleotide Sequence: 282 bp     [Download]
>gi|110632362|ref|NC_008254.1|:c562197-561916 Chelativorans sp. BNC1 chromosome, complete genome
ATGGCGGGCCTCCTGCATCATCCCGATGAAGTCGCGGGCTTCTCGGTTCCGGTCCACCGCGCGCTGACCG
AGCAGATCCTGCTGGGCGGCGCACCGCGCAGCATCGCCATCATGAACGGCACACTCGCCGGCGCTGTCGG
TCTCGGATTGCGGCTATGGCTGGTTGGTCTCCTCATCTGGGCGATCGGCCATTTCGCCGCCGTTTGGGCA
GCAAAGCGCGATCCGCTCTTTGTCGAAGTGGGCCGCCGGCATCTGCGCATTCCGGGCCATCTCTCGGTGT
GA
 Primer design