SecReT4
Protein ID: 110632868
T4SS name [ID]Trb [269]
Gene symbol-
Locus tagMeso_0508
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]562197..562529 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ11L14
KEGG IDmes:Meso_0508
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.7e-25, Aligned region: 9..100
Protein Sequence: 110 a.a.     [Download]
>gi|110632868|ref|YP_673076.1| conjugal transfer protein TrbC [Chelativorans sp. BNC1]
MIQPIARGHQRLATAATALTLSFLLAPAAHASGSSMPWEAPLQSILQSIEGPVAKIIAVIIIIVTGLTLA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 333 bp     [Download]
>gi|110632362|ref|NC_008254.1|:c562529-562197 Chelativorans sp. BNC1 chromosome, complete genome
ATGATCCAACCTATCGCGCGCGGCCATCAGCGCCTCGCAACCGCCGCCACGGCGCTGACCCTGAGCTTTC
TTCTGGCGCCCGCCGCCCATGCATCCGGCTCCTCGATGCCCTGGGAAGCGCCGCTGCAGTCCATCCTGCA
GTCGATCGAGGGGCCGGTCGCCAAGATCATCGCGGTGATCATCATCATCGTCACCGGCCTGACACTGGCG
TTCGGCGACACGAGCGGAGGATTTCGGCGCCTCATCCAGATCGTCTTCGGCCTGTCGATCGCCTTCGCGG
CGTCCAGCTTCTTCCTGTCGTTCTTCTCGTTCGGCGGCGGGGCGCTCGTCTGA
 Primer design