SecReT4
Protein ID: 110632869
T4SS name [ID]Trb [269]
Gene symbol-
Locus tagMeso_0509
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]562526..563515 [-]
Producttype II secretion system protein E
Component typeTrbB
UniProt IDQ11L13
KEGG IDmes:Meso_0509
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.2e-88, Aligned region: 26..290
FtsK_SpoIIIE [PF01580], Evalue: 2.6e-05, Aligned region: 145..178
Protein Sequence: 329 a.a.     [Download]
>gi|110632869|ref|YP_673077.1| type II secretion system protein E [Chelativorans sp. BNC1]
MAVNHQQSEAASRGARMLRTALGPAVARFLEDPAIVEVMLNPDGRLWVDRLSDGLSDTGERLSAADGERI
IRLVAHHVGAEVHDRRPRVSAELPETGERFEGLLPPVVTAPVFAIRKPAVAVFTLDDYVAAGIMTADQAA
ILRQAVAARANVLVAGGTSTGKTTLTNALLAEVAKTTDRVIVIEDTRELQCRAQNIIAMRTKDGVATLSD
LVRSSLRLRPDRIPIGEVRGAEALDLLKAWGTGHPGGIGTIHAGTALGALRRLEQLIQEAVVTVPRALIA
ETIDLVAVLSGRGAARRLAELARVEGLGTDTDYRLSPATQPPDPQGEPA
 
Nucleotide Sequence: 990 bp     [Download]
>gi|110632362|ref|NC_008254.1|:c563515-562526 Chelativorans sp. BNC1 chromosome, complete genome
GTGGCGGTCAACCATCAGCAATCGGAAGCAGCCTCACGCGGTGCACGCATGCTGCGCACCGCGCTGGGGC
CTGCGGTCGCCCGATTCCTGGAAGACCCCGCGATCGTCGAGGTCATGCTCAACCCCGATGGGCGGCTCTG
GGTCGACCGGCTCTCTGACGGCCTGTCCGATACGGGGGAACGACTTTCGGCCGCCGATGGCGAACGCATC
ATCCGCCTCGTCGCCCATCATGTCGGTGCCGAGGTGCATGACCGACGGCCGCGTGTCTCGGCTGAACTGC
CCGAAACCGGCGAGCGCTTCGAAGGCCTGCTGCCGCCGGTCGTGACGGCTCCGGTCTTTGCGATTCGCAA
GCCTGCCGTCGCCGTCTTCACGCTCGACGACTATGTCGCCGCGGGCATCATGACGGCCGACCAGGCCGCC
ATCCTCCGGCAGGCGGTCGCAGCGCGCGCCAACGTCCTCGTTGCCGGCGGAACCAGCACCGGCAAGACCA
CGCTGACCAATGCCCTGCTGGCCGAGGTCGCGAAGACAACCGACCGCGTCATCGTCATCGAAGACACCCG
CGAGCTGCAATGCAGGGCGCAGAACATCATCGCCATGCGCACCAAGGACGGCGTCGCGACCCTGTCCGAC
CTGGTGCGCTCCTCGCTGCGGCTGCGGCCGGATCGGATCCCGATCGGCGAGGTGCGTGGGGCTGAGGCGC
TCGATCTCCTGAAGGCCTGGGGCACCGGCCATCCCGGCGGGATCGGCACGATCCACGCGGGCACCGCGCT
CGGCGCGCTGCGCCGCCTCGAGCAGCTCATCCAGGAAGCTGTCGTCACCGTCCCCCGGGCGCTGATCGCC
GAGACCATCGATCTGGTGGCCGTGCTCTCCGGCCGCGGCGCAGCGCGGCGTCTCGCCGAACTCGCGCGCG
TCGAAGGGCTCGGGACGGACACCGACTACCGCCTTTCCCCCGCAACCCAGCCTCCCGACCCACAAGGAGA
ACCCGCATGA
 Primer design