SecReT4
Protein ID: 110632875
T4SS name [ID]Trb [269]
Gene symbol-
Locus tagMeso_0515
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]569664..571652 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDQ11L07
KEGG IDmes:Meso_0515
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7.4e-102, Aligned region: 115..553
TraG-D_C [PF12696], Evalue: 5.8e-31, Aligned region: 401..522
TrwB_AAD_bind [PF10412], Evalue: 7.7e-30, Aligned region: 171..536
AAA_10 [PF12846], Evalue: 1.2e-06, Aligned region: 370..478
Protein Sequence: 662 a.a.     [Download]
>gi|110632875|ref|YP_673083.1| conjugal transfer coupling protein TraG [Chelativorans sp. BNC1]
MSATKILWGQITTVFLIVLLTTWGATQWTAWRLGFQAQLGTPWFELAGWPVYYPPAFFWWWYFYDAYAPP
IFVEGAMIAASGGFISIAVAIAMSVWRAREAKNVETYGSARWAEIREVKAAGLLGPDGVVLGKLGDAYLR
HDGPEHVLCFAPTRSGKGVGLVVPTLLTWPGSAIVHDIKGENWQLTAGFRARHGRVLLFDPTNAKSAAYN
PLLEVRRGEWEVRDVQNVADVLVDPEGSLDKRNHWEKTSHSLLVGAILHVLYAEEEKTLAGVAAFLSDPR
RPIEATLKAMMTTPHLGLGGPHPVVASTARELLNKSDNERSGVLSTAMSFLGLYRDPVVAEVTRRCDWRI
ADLIADEKPATLYLVVPPSDISRTKPLIRLVLNQIGRRLTEDLHARDRRHRVLMMLDEFPALGRLDFFES
ALAFMAGYGLKSFLIAQSLNQIEKAYGPNNAILDNCHVRVSFATNDERTAKRVSDALGTATEMKAMRNYA
GHRLSPWLGHLMVSRSETARPLLTPGEVMQLPATDEIVMAAGVHPIRAKKARYFEDRRFKERILPSPDPA
KCGRSARRDAWSELKPQRPDALLAAELDKAEDAANGGLRREPELPDHVAIAKETTGPAAADEFSIMLDDE
PEDAARQRQALRQQMRGVARQVALDPNDGIEL
 
Nucleotide Sequence: 1989 bp     [Download]
>gi|110632362|ref|NC_008254.1|:c571652-569664 Chelativorans sp. BNC1 chromosome, complete genome
ATGTCTGCGACGAAAATCCTCTGGGGCCAGATCACCACCGTGTTCCTCATCGTGCTGCTCACGACCTGGG
GCGCGACCCAATGGACCGCCTGGCGGCTCGGTTTTCAGGCGCAGCTCGGCACGCCGTGGTTCGAGCTGGC
GGGTTGGCCGGTCTACTATCCACCCGCCTTCTTCTGGTGGTGGTACTTCTACGACGCCTATGCCCCGCCG
ATCTTTGTTGAAGGCGCTATGATCGCCGCCTCAGGCGGCTTCATCTCCATCGCCGTCGCCATCGCAATGT
CGGTATGGCGCGCCCGTGAGGCGAAGAATGTCGAGACCTACGGCTCGGCCCGCTGGGCTGAAATCCGGGA
GGTGAAGGCGGCAGGACTGCTCGGACCCGATGGCGTCGTCCTCGGAAAGCTAGGCGACGCCTATCTCCGA
CATGATGGACCCGAGCATGTCCTGTGCTTCGCACCAACCCGATCGGGCAAGGGTGTCGGTCTCGTTGTCC
CGACGCTCCTCACCTGGCCGGGCTCCGCCATCGTCCACGATATCAAGGGCGAGAACTGGCAGCTGACCGC
CGGCTTCCGCGCGAGGCACGGCCGCGTCCTGCTGTTCGATCCCACCAACGCCAAGTCGGCCGCCTACAAT
CCGCTCCTGGAAGTGCGACGGGGAGAGTGGGAAGTTCGCGACGTGCAAAACGTCGCCGACGTTCTCGTCG
ACCCCGAGGGCTCACTCGACAAGCGCAATCACTGGGAGAAGACGAGCCATTCTTTGCTCGTCGGTGCCAT
CCTGCATGTGCTGTACGCGGAAGAGGAGAAGACGCTCGCCGGTGTAGCCGCCTTCCTGTCGGATCCGCGC
CGTCCGATCGAAGCCACGCTGAAGGCGATGATGACGACGCCCCATCTCGGCCTTGGTGGCCCTCATCCCG
TCGTGGCGTCGACAGCGCGCGAACTCCTCAACAAGAGCGACAACGAGCGCTCGGGCGTCCTGTCCACCGC
CATGTCCTTCCTGGGCCTCTACCGCGATCCGGTGGTGGCGGAGGTGACGCGCCGCTGCGACTGGCGGATC
GCCGACCTCATCGCCGATGAGAAGCCAGCAACGCTCTACCTTGTGGTTCCGCCATCCGACATCTCCCGGA
CGAAGCCGTTGATCCGGCTCGTGCTCAACCAGATCGGCCGACGCCTGACCGAGGATCTGCATGCGCGAGA
CCGGCGGCATCGTGTGCTGATGATGCTCGACGAGTTTCCAGCTCTCGGCCGCCTCGACTTCTTTGAGAGC
GCGCTCGCCTTCATGGCGGGCTACGGCCTGAAGTCGTTCCTCATAGCCCAGTCATTGAACCAGATCGAAA
AGGCCTATGGCCCGAACAATGCGATCCTCGACAACTGCCATGTGCGCGTGAGCTTCGCCACCAATGACGA
GCGCACCGCCAAGCGCGTGAGCGACGCCCTCGGTACGGCGACCGAGATGAAGGCGATGCGGAACTATGCC
GGGCATCGGCTCAGCCCCTGGCTCGGTCATCTGATGGTCTCGCGCTCGGAGACGGCGCGGCCGCTCCTTA
CCCCTGGCGAGGTGATGCAGCTACCGGCGACGGATGAAATCGTGATGGCCGCCGGTGTCCATCCCATCCG
AGCCAAGAAGGCCCGTTACTTCGAGGATCGCCGCTTCAAGGAGCGCATCCTGCCGTCACCCGACCCGGCG
AAATGCGGGCGTTCGGCCCGAAGGGACGCCTGGTCCGAGTTGAAACCGCAGCGGCCCGACGCATTGCTCG
CGGCTGAGCTCGACAAGGCGGAAGACGCTGCCAATGGCGGTCTGCGGCGCGAGCCCGAACTGCCCGACCA
TGTCGCGATCGCCAAGGAGACGACCGGACCTGCCGCGGCCGACGAGTTTTCCATCATGCTGGACGATGAG
CCGGAAGACGCGGCGCGGCAGCGTCAGGCGCTGCGCCAGCAGATGCGCGGCGTGGCGAGACAGGTCGCGC
TCGATCCCAATGACGGCATCGAACTGTGA
 Primer design