SecReT4
Protein ID: 110632877
T4SS name [ID]Trb [269]
Gene symbol-
Locus tagMeso_0517
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]573691..574455 [-]
Productlytic transglycosylase, catalytic
Component typeTrbN
UniProt IDQ11L05
KEGG IDmes:Meso_0517
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 254 a.a.     [Download]
>gi|110632877|ref|YP_673085.1| lytic transglycosylase, catalytic [Chelativorans sp. BNC1]
MRVSHRQPAAGAKGAARRFPFILLSGLAFAGAMPAPSLAQTSLIERPAAGSPYTQAVAEAAQRFGIPERW
IWAVMRVESGGRVRAVSPKGAMGLMQIMPATWADLRARHSLGADPFDPRDNILAGAAYLREMHDRYGAPG
FLAAYNAGPGRYDDYLSAGRALPAETIAYVAAIAPLIGSEPLAAGVAVATIDPLAWTRSPLFVARSEGSV
AAERSQPDRQRNGSRTAHPQQPPIAGSTQTAGIFVTRADDGGRP
 
Nucleotide Sequence: 765 bp     [Download]
>gi|110632362|ref|NC_008254.1|:c574455-573691 Chelativorans sp. BNC1 chromosome, complete genome
ATGCGCGTCTCCCATCGCCAGCCCGCTGCCGGAGCGAAAGGGGCCGCCCGCCGATTCCCCTTCATTCTCC
TTTCCGGCCTGGCCTTTGCCGGCGCGATGCCCGCGCCGTCTCTGGCGCAGACCTCGCTCATCGAGCGACC
CGCTGCAGGCTCGCCCTACACACAAGCGGTCGCCGAGGCAGCGCAGCGGTTCGGCATTCCCGAGCGCTGG
ATCTGGGCAGTCATGCGCGTCGAGAGCGGCGGTCGTGTCCGCGCGGTCTCGCCCAAAGGCGCGATGGGAC
TCATGCAGATCATGCCCGCGACCTGGGCGGATCTGCGGGCGCGCCACAGTCTGGGGGCCGATCCCTTTGA
CCCTCGCGACAACATCCTCGCTGGCGCAGCCTATCTGCGCGAAATGCACGACCGCTACGGCGCGCCGGGC
TTTCTCGCGGCCTACAATGCCGGCCCCGGGCGGTACGATGACTATCTCTCGGCTGGCCGCGCGCTGCCCG
CCGAGACCATCGCCTACGTGGCCGCGATCGCGCCGTTGATCGGCAGTGAGCCGCTCGCTGCCGGCGTCGC
TGTCGCGACCATCGACCCGCTCGCGTGGACTCGGTCTCCGTTGTTCGTCGCGCGCTCCGAAGGCAGCGTT
GCAGCAGAACGATCGCAGCCCGATCGCCAAAGGAACGGCAGCCGAACCGCACATCCGCAGCAACCCCCAA
TTGCCGGTTCGACGCAGACGGCAGGCATCTTCGTGACCCGCGCCGATGATGGGGGGCGTCCATGA
 Primer design