SecReT4
Protein ID: 110632879
T4SS name [ID]Trb [269]
Gene symbol-
Locus tagMeso_0519
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]574843..575388 [-]
ProductTraF peptidase
Component typeTraF
UniProt IDQ11L03
KEGG IDmes:Meso_0519
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 3.1e-53, Aligned region: 29..166
Protein Sequence: 181 a.a.     [Download]
>gi|110632879|ref|YP_673087.1| TraF peptidase [Chelativorans sp. BNC1]
MTRAGYLLTATGAALLLITLAMVHVAPRLVWNASASVPVGLYEIGSATPLEVTDLVAVNAPEPLAAFLAD
RGYLPRGVPLLKRVAALPGQTVCRSEGDISVDGITVGNALDRDRLGRTLPIWRGCHRIGASELFLMNIGV
RDSLDGRYFGPLAVTTVIGRATPLYTDEDGDGRFVWRAPTR
 
Nucleotide Sequence: 546 bp     [Download]
>gi|110632362|ref|NC_008254.1|:c575388-574843 Chelativorans sp. BNC1 chromosome, complete genome
ATGACGCGCGCCGGCTACCTGCTGACGGCCACTGGCGCCGCGCTCCTGCTGATCACGCTGGCGATGGTGC
ACGTTGCACCGCGGCTCGTCTGGAACGCATCGGCCAGCGTCCCGGTCGGCCTCTATGAGATCGGCTCGGC
TACGCCGCTCGAGGTCACCGACCTTGTCGCGGTCAATGCGCCGGAGCCGCTTGCCGCATTCCTCGCGGAC
CGGGGTTATCTGCCGCGCGGCGTACCGCTCTTGAAGCGCGTTGCCGCACTTCCCGGGCAGACAGTCTGCC
GTTCGGAAGGGGACATTAGCGTCGACGGGATCACCGTCGGCAATGCGCTCGACCGCGACCGTCTGGGACG
CACGCTGCCTATCTGGAGAGGCTGCCACCGGATCGGCGCGAGCGAACTCTTCCTCATGAACATCGGCGTC
CGGGACAGCCTGGACGGCCGCTACTTCGGGCCTCTCGCCGTCACCACCGTGATCGGCCGGGCCACGCCTC
TCTACACCGACGAAGACGGCGATGGTCGCTTCGTCTGGCGCGCGCCGACGCGGTGA
 Primer design