SecReT4
Protein ID: 110634661
T4SS name [ID]Trb [270]
Gene symbol-
Locus tagMeso_2316
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]2470365..2471321 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDQ11FX1
KEGG IDmes:Meso_2316
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2e-62, Aligned region: 95..311
Protein Sequence: 318 a.a.     [Download]
>gi|110634661|ref|YP_674869.1| conjugal transfer protein TrbG/VirB9/CagX [Chelativorans sp. BNC1]
MTADFRKGAIAATLVSATMLAGCATKRPPQMSFDADVPPLPAVPAVVTDNAPRPLHIPPAWTPSRGGAKA
NSPTARVENANAVARVEPLREGYYNAIQIYPWSDGALYQVYAAPGQITDIALEPGESLTGAGPIAAGDTA
RWIIGDTESGNGATRRVHVLVKPTRPDITTNLVITTDRRTYMIELRSGEKPYMPAVAWAYPQPPASRRQT
LPATPIIPGLAARNYRYGLTGDRPPWRPISVYDDGRRVYVEFPRGIVQGEMPPLFVVGSDGELQIANSRV
YRNILIVDHLFGAAELRLGSGKRQQTVRIVRTDGRPST
 
Nucleotide Sequence: 957 bp     [Download]
>gi|110632362|ref|NC_008254.1|:c2471321-2470365 Chelativorans sp. BNC1 chromosome, complete genome
ATGACAGCTGATTTCCGCAAAGGCGCAATCGCGGCAACGCTGGTCTCCGCAACCATGCTCGCCGGCTGCG
CGACGAAGCGGCCGCCGCAGATGAGCTTCGACGCCGATGTGCCCCCATTGCCGGCCGTTCCGGCTGTCGT
CACGGACAACGCGCCGCGGCCGCTGCATATCCCGCCGGCGTGGACGCCGAGCCGGGGTGGCGCGAAGGCC
AACTCGCCGACCGCCCGCGTCGAGAACGCCAACGCCGTAGCCCGCGTCGAACCGCTCCGCGAGGGCTACT
ACAATGCGATCCAGATCTATCCGTGGAGCGACGGCGCACTCTATCAGGTCTATGCGGCGCCCGGCCAGAT
CACAGACATCGCGCTCGAGCCCGGCGAGAGCCTGACCGGGGCCGGTCCGATCGCGGCCGGCGATACGGCG
CGCTGGATCATCGGCGACACCGAGAGCGGCAACGGTGCGACGCGGCGTGTGCATGTGCTCGTCAAGCCCA
CGCGGCCGGACATCACCACCAATCTGGTCATCACCACCGACCGGCGCACCTACATGATCGAGCTGCGCTC
GGGCGAGAAACCCTATATGCCGGCCGTCGCCTGGGCCTATCCACAGCCCCCAGCCTCGCGGCGCCAGACC
CTGCCGGCCACACCGATTATTCCCGGCCTTGCAGCACGGAACTACCGCTACGGGCTCACGGGCGACAGGC
CGCCTTGGCGGCCGATCTCTGTCTATGACGACGGGCGGCGCGTCTATGTCGAATTCCCACGCGGCATCGT
GCAAGGCGAAATGCCGCCGCTCTTCGTCGTCGGCTCCGACGGCGAACTCCAGATCGCCAACAGTCGCGTC
TATCGGAACATTCTGATCGTCGACCACCTGTTCGGTGCGGCCGAGCTGCGCCTAGGCAGCGGCAAGCGCC
AGCAGACCGTCAGGATCGTACGCACGGATGGGAGACCATCGACATGA
 Primer design