SecReT4
Protein ID: 110634663
T4SS name [ID]Trb [270]
Gene symbol-
Locus tagMeso_2318
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]2472004..2473350 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ11FW9
KEGG IDmes:Meso_2318
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 8.5e-52, Aligned region: 37..262
Protein Sequence: 448 a.a.     [Download]
>gi|110634663|ref|YP_674871.1| conjugal transfer protein TrbL [Chelativorans sp. BNC1]
MGGAGVIDDFLSVFTSYIDSGFGLLGGEVAFIATTLIVIDVTLAALFWSWGADDDIIARLIKKTLFVGVF
AYLISNWNSLARIVFESFAGLGLQASGTGFSEQDLMRPGLVAQTGLDAARPLLESISDLMGWVAFFENFI
QIACLLFAWALVLLAFFILAIQLFVTLIEFKLTTLAGFVLIPFGLFGKTAFMAERVLGNVISSGTKVLVL
AVIIGIGSTLFGQFTQGFGGQTPTIDEAMAVVLAALSLLGLGIFGPGIANGIVSGGPQLGAGSAVGTGLA
VGGMVLAGGAAAGLAARGGATVISTGAAAVRGGAAAAGAASAGYSLGSLGQSCATGVASGLGGMARAAGG
TAASPLRRAVGSLRSSFSAGARSGFDATGGSSTMGTISDAGAAPASPAHISDGPPAWAQRMKRGRAVSHG
ITAAAHAVRSGDSQGGGSSVNLSEGDKK
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|110632362|ref|NC_008254.1|:c2473350-2472004 Chelativorans sp. BNC1 chromosome, complete genome
ATGGGCGGCGCCGGCGTTATCGACGATTTCCTGTCGGTCTTCACCAGCTACATCGACTCCGGCTTCGGTC
TGCTCGGCGGCGAGGTGGCCTTCATCGCTACCACGCTGATCGTCATCGACGTGACGCTGGCCGCGCTGTT
CTGGAGTTGGGGCGCCGATGACGACATCATCGCGCGCCTCATAAAGAAGACGCTGTTTGTCGGCGTCTTC
GCCTACCTGATTTCCAACTGGAACTCGCTCGCCCGCATCGTGTTCGAGAGCTTCGCTGGGCTCGGCCTGC
AAGCCTCAGGCACCGGCTTCTCAGAGCAGGACCTGATGCGTCCCGGTCTGGTCGCTCAAACCGGGCTCGA
TGCCGCCCGGCCACTGCTGGAGAGCATCTCCGACCTGATGGGCTGGGTCGCGTTTTTCGAGAACTTCATC
CAGATCGCCTGCCTTCTGTTCGCCTGGGCACTGGTCCTGCTTGCCTTCTTCATTCTGGCGATCCAGCTCT
TCGTCACACTCATCGAATTCAAGCTGACGACGCTCGCCGGCTTCGTGCTGATCCCCTTCGGCCTGTTCGG
CAAAACGGCCTTCATGGCTGAGCGCGTCCTCGGGAACGTGATTTCCTCCGGCACCAAGGTGCTGGTGCTC
GCCGTCATCATCGGCATCGGCTCGACTTTGTTTGGTCAGTTCACCCAAGGTTTCGGTGGCCAGACGCCGA
CCATCGACGAGGCGATGGCCGTCGTTCTCGCCGCGCTCTCACTGCTCGGCCTCGGCATCTTCGGCCCTGG
CATCGCCAACGGCATCGTTTCCGGCGGCCCGCAACTCGGTGCTGGGTCCGCTGTCGGCACCGGGCTCGCA
GTCGGCGGCATGGTTCTCGCCGGCGGCGCGGCTGCTGGCCTTGCCGCGAGAGGTGGCGCGACGGTGATTT
CCACTGGAGCGGCGGCTGTCCGTGGCGGTGCAGCCGCAGCAGGAGCCGCCTCCGCCGGCTACAGCCTCGG
TTCCCTCGGCCAATCGTGCGCGACCGGCGTTGCCTCGGGGCTTGGAGGCATGGCGCGGGCGGCGGGAGGC
ACGGCGGCGTCACCCCTTCGCCGTGCAGTGGGAAGCCTCAGGTCCAGTTTCTCCGCCGGCGCGAGGAGCG
GCTTTGACGCGACCGGCGGCTCTTCGACCATGGGCACGATATCCGATGCCGGCGCAGCCCCTGCATCGCC
GGCGCACATCTCTGACGGCCCGCCGGCCTGGGCACAGCGCATGAAGCGCGGCCGGGCGGTGAGCCACGGC
ATCACGGCCGCCGCGCACGCCGTCCGCTCCGGCGACAGCCAAGGCGGCGGCTCTTCCGTCAACCTCTCCG
AAGGCGACAAGAAATGA
 Primer design