SecReT4
Protein ID: 110634668
T4SS name [ID]Trb [270]
Gene symbol-
Locus tagMeso_2323
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]2477141..2477473 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ11FW4
KEGG IDmes:Meso_2323
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.5e-25, Aligned region: 9..100
Protein Sequence: 110 a.a.     [Download]
>gi|110634668|ref|YP_674876.1| conjugal transfer protein TrbC [Chelativorans sp. BNC1]
MIRFVSRGCRHMATAVAAVSVSLMLAPSAHASGSSMPWEQPLQQILESIEGPVAKIIAVIIIIITGLTLA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 333 bp     [Download]
>gi|110632362|ref|NC_008254.1|:c2477473-2477141 Chelativorans sp. BNC1 chromosome, complete genome
ATGATCCGTTTCGTCTCGCGCGGCTGCCGGCATATGGCGACGGCCGTCGCCGCTGTGTCCGTCAGCCTGA
TGCTGGCGCCCTCTGCCCATGCTTCGGGTTCGTCCATGCCGTGGGAGCAGCCGCTCCAGCAGATCCTGGA
GTCGATCGAGGGGCCGGTCGCCAAGATCATCGCGGTCATCATTATCATCATCACCGGCTTGACGCTGGCT
TTTGGCGATACCAGCGGCGGTTTTCGCCGCCTGATCCAGATCGTCTTCGGTCTGTCGATCGCATTTGCCG
CCAGTTCGTTCTTCTTGTCGTTCTTCTCGTTCGGCGGCGGGGCGCTGGTCTGA
 Primer design