SecReT4
Protein ID: 110636169
T4SS name [ID]Trb [271]
Gene symbol-
Locus tagMeso_3845
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]4146990..4147550 [+]
ProductTraF peptidase
Component typeTraF
UniProt IDQ11BL3
KEGG IDmes:Meso_3845
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 2.5e-52, Aligned region: 30..167
Protein Sequence: 186 a.a.     [Download]
>gi|110636169|ref|YP_676377.1| TraF peptidase [Chelativorans sp. BNC1]
MSPRRLTLVVMLAGTALVAAPTWTGHGPRFIWNTSASVPIGLYGIEPVGQVDVADLVAVAPPEPLAEFLA
ERGYLARNVPLIKRVLAVSGTVVCRHGTTIIAYGHAYGEARNQDALGRPLPSWQGCRQLGENEVFLMNWD
ASDSFDGRYFGPLPTSSITARVIPVWTDETGDGRFRWRAADPALQP
 
Nucleotide Sequence: 561 bp     [Download]
>gi|110632362|ref|NC_008254.1|:4146990-4147550 Chelativorans sp. BNC1 chromosome, complete genome
ATGAGCCCGCGCCGCCTCACGCTTGTCGTCATGCTCGCGGGCACCGCGTTGGTGGCCGCGCCAACGTGGA
CCGGCCACGGGCCGCGCTTCATCTGGAACACCTCGGCGAGTGTGCCGATCGGGCTCTACGGCATCGAGCC
GGTCGGTCAGGTCGACGTCGCCGATCTCGTCGCTGTGGCGCCGCCAGAACCGCTCGCCGAGTTCCTCGCG
GAGCGCGGCTATCTCGCACGCAACGTTCCGCTCATCAAACGTGTCCTCGCAGTCTCGGGCACCGTTGTCT
GCCGGCATGGAACGACGATCATCGCCTATGGCCACGCCTATGGCGAGGCCCGCAATCAAGATGCGCTGGG
CCGCCCTCTGCCGTCCTGGCAAGGCTGCCGGCAGCTCGGCGAAAACGAGGTGTTCCTGATGAACTGGGAC
GCCTCCGACAGCTTCGATGGCCGGTATTTCGGTCCGCTTCCCACTAGCTCGATCACCGCCCGCGTCATCC
CTGTCTGGACCGACGAGACCGGCGACGGCCGCTTCCGATGGCGGGCGGCCGATCCGGCTCTCCAACCCTG
A
 Primer design