SecReT4
Protein ID: 110636171
T4SS name [ID]Trb [271]
Gene symbol-
Locus tagMeso_3847
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]4147932..4148654 [+]
Productlytic transglycosylase, catalytic
Component typeTrbN
UniProt IDQ11BL1
KEGG IDmes:Meso_3847
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 240 a.a.     [Download]
>gi|110636171|ref|YP_676379.1| lytic transglycosylase, catalytic [Chelativorans sp. BNC1]
MPVLCIGQAGRQCGGRRHIASLLLTGLVLAIAPPPVTMAQTVPVERPEIGGPYAAFIAEAAQRFGMPALW
IAAVLDAESAGDQRAVSSAGARGLMQVMPDTWAELRVRYRFGDDPFAARDNIMAGAAYLREMWDLYGNVG
AMLAAYNAGPGRYDEYLSTGRPLPAETRAYVTALAPILGREPLPEGVISRPPVPADWREAPLFVTGFDAV
PTAPHSPAESADPEPSETIFVPRAGDGVQP
 
Nucleotide Sequence: 723 bp     [Download]
>gi|110632362|ref|NC_008254.1|:4147932-4148654 Chelativorans sp. BNC1 chromosome, complete genome
ATGCCGGTTCTCTGCATCGGGCAGGCAGGCAGGCAGTGCGGCGGTCGTCGCCACATCGCCTCCCTCCTAC
TTACCGGCCTTGTGCTCGCCATCGCTCCGCCGCCGGTCACCATGGCGCAGACCGTGCCGGTCGAGCGCCC
CGAAATCGGCGGTCCCTACGCGGCATTTATCGCCGAGGCCGCACAGCGTTTCGGCATGCCCGCGCTGTGG
ATCGCGGCCGTGCTCGACGCGGAAAGCGCTGGCGATCAGCGCGCCGTTTCCTCGGCTGGCGCGCGGGGAT
TGATGCAGGTCATGCCGGACACCTGGGCCGAGCTGCGCGTGCGCTATCGGTTTGGCGACGACCCGTTCGC
GGCGCGCGACAACATCATGGCCGGCGCCGCATATCTCCGCGAGATGTGGGACCTTTACGGCAATGTCGGT
GCGATGCTCGCCGCGTACAATGCCGGGCCCGGCCGCTACGACGAATACCTCTCCACGGGCCGCCCCCTGC
CGGCCGAGACGCGCGCATACGTCACCGCGCTCGCCCCTATTCTCGGCCGCGAACCGCTGCCCGAGGGCGT
GATTTCGCGTCCTCCCGTTCCGGCCGATTGGCGTGAAGCACCATTGTTCGTTACGGGCTTCGACGCCGTT
CCGACAGCGCCTCACTCGCCTGCGGAATCGGCCGATCCGGAGCCGAGCGAGACCATCTTCGTCCCCCGTG
CAGGCGACGGAGTCCAGCCATGA
 Primer design