SecReT4
Protein ID: 110636173
T4SS name [ID]Trb [271]
Gene symbol-
Locus tagMeso_3849
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]4150685..4152679 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDQ11BK9
KEGG IDmes:Meso_3849
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.9e-104, Aligned region: 111..557
TraG-D_C [PF12696], Evalue: 2.4e-31, Aligned region: 401..522
TrwB_AAD_bind [PF10412], Evalue: 2.2e-29, Aligned region: 172..537
AAA_10 [PF12846], Evalue: 1.4e-06, Aligned region: 370..478
Protein Sequence: 664 a.a.     [Download]
>gi|110636173|ref|YP_676381.1| conjugal transfer coupling protein TraG [Chelativorans sp. BNC1]
MTQTKILWGQIIIVSLIVLTSVWGGTQWVAWRLGFQPQLGQPWFELFGWPVYLPPSLMWWWFSFEAYAPR
IFWEGGIIAASGGILSIAVAITMSVIRAREATGLDTYGSARWAEKRDIAAAGLLGRDGVVLGKFERDYLR
HDGPEHVLCFAPTRSGKGVGLVVPTLLTWPGSCVVHDIKGENWQLTAGFRARHGRALLFDPTNANSAAYN
PLLEVRKGEWEVRDVQNVADVLVDPEGSLEKRNHWEKTSHSLLVGAILHVLYAEADKTLAGVAGFLSDPR
RPIETTLKAMMTTPHLGEKGPHPVVASAARELLNKSDNERSGVLSTAMSFLGLYRDPVVAHVTRRCDWRI
ADLVSGERPASLYLVVPPSDISRTKPLIRLVLNQIGRRLTEDLNAKDRRHRVLMMLDEFPALGRLDFFES
ALAFMAGYGIKSFLIAQSLNQIEKAYGQNNSILDNCHVRVSFATNDERTAKRISDALGTATELKAMQNYA
GHRLAPWLGHLMVSRSETARQLLTPGEVMQLPPDDEIVMIAGSPPIRATKARYFEDVRFTERVLQPPDPT
TEQRVSLADGWSELEPRKPDAVLLAEVDKAEQDRANAGLRREPELPQHVEIVHDTTEPTPEREFALVEDN
AEDRLRQAQNQALRRQMRGVARQVSMNPDEGMDL
 
Nucleotide Sequence: 1995 bp     [Download]
>gi|110632362|ref|NC_008254.1|:4150685-4152679 Chelativorans sp. BNC1 chromosome, complete genome
ATGACGCAGACCAAAATCCTTTGGGGCCAGATCATCATCGTCTCCCTGATCGTGCTGACCTCCGTGTGGG
GCGGCACGCAATGGGTGGCCTGGCGTCTCGGCTTCCAGCCTCAGCTCGGTCAGCCCTGGTTCGAGCTATT
CGGGTGGCCGGTCTATCTGCCGCCGTCGCTGATGTGGTGGTGGTTTTCGTTCGAGGCTTACGCACCGCGC
ATCTTCTGGGAGGGCGGCATCATCGCAGCCTCCGGCGGCATCCTGTCGATTGCCGTCGCCATCACCATGT
CGGTGATCCGTGCCCGTGAGGCGACCGGACTCGACACCTACGGCTCGGCGCGGTGGGCCGAAAAGAGGGA
TATCGCGGCGGCGGGCCTGCTCGGTCGGGATGGTGTCGTGCTCGGAAAGTTCGAACGGGACTATCTCAGA
CACGACGGGCCGGAGCATGTGTTGTGCTTTGCCCCGACACGGAGCGGCAAGGGCGTTGGCCTGGTCGTGC
CGACGCTGCTCACCTGGCCAGGCAGTTGCGTCGTGCATGACATCAAAGGCGAAAACTGGCAGCTCACTGC
CGGCTTCCGCGCACGGCACGGTCGCGCCCTCCTGTTCGATCCCACCAACGCCAACTCGGCCGCCTACAAT
CCGCTGCTCGAAGTCAGGAAGGGGGAGTGGGAAGTTCGGGACGTTCAGAACGTGGCCGACGTGCTGGTCG
ATCCGGAAGGTTCACTGGAGAAACGGAATCACTGGGAAAAGACCTCCCACTCGCTGCTCGTCGGCGCGAT
CCTCCACGTCCTCTATGCCGAGGCCGACAAGACGCTCGCTGGCGTGGCCGGCTTCCTCTCCGATCCGCGC
CGGCCGATTGAGACGACTTTGAAGGCCATGATGACCACGCCGCATCTCGGCGAAAAGGGTCCGCACCCTG
TCGTCGCGTCGGCCGCACGCGAGCTGCTGAACAAGTCAGACAATGAACGCTCGGGCGTTCTGTCCACCGC
CATGTCGTTCCTCGGCCTCTATCGCGATCCCGTCGTCGCCCACGTCACGCGCCGCTGCGACTGGCGCATC
GCCGACCTCGTCTCGGGCGAGCGCCCGGCTAGCCTTTACCTCGTGGTGCCGCCCTCCGACATATCGCGGA
CAAAGCCGCTCATCAGGCTGGTGCTCAACCAGATCGGCCGCAGGCTCACCGAGGATCTGAACGCCAAGGA
TCGACGGCATCGAGTGCTGATGATGCTCGACGAGTTTCCGGCTTTGGGCCGCCTGGACTTTTTCGAGAGC
GCTTTGGCCTTTATGGCGGGCTACGGGATCAAGAGCTTCCTCATCGCTCAGAGCCTCAACCAGATCGAGA
AGGCGTATGGGCAGAACAATTCGATTCTCGACAACTGCCATGTCCGGGTGAGCTTCGCCACCAACGACGA
GAGGACAGCCAAGCGTATCAGCGACGCTCTCGGCACCGCGACCGAGCTGAAGGCCATGCAGAACTATGCC
GGCCACCGCCTCGCACCCTGGTTGGGACACTTGATGGTGTCGCGCTCGGAAACCGCGCGGCAGCTCCTCA
CCCCCGGCGAGGTGATGCAGTTGCCGCCAGACGACGAGATCGTGATGATTGCCGGCTCGCCGCCGATCCG
GGCAACGAAGGCACGCTATTTCGAGGACGTTCGCTTCACCGAACGCGTTCTGCAACCCCCCGATCCGACG
ACCGAGCAGCGCGTCTCGCTCGCCGATGGCTGGTCGGAGCTTGAACCTCGAAAGCCAGACGCGGTGCTCC
TGGCCGAAGTTGATAAGGCCGAGCAGGACCGCGCCAACGCGGGTCTACGTCGGGAGCCTGAGCTGCCGCA
GCATGTCGAGATCGTCCATGACACCACGGAGCCGACCCCCGAACGTGAGTTCGCCCTGGTCGAGGACAAT
GCCGAGGACCGACTACGGCAGGCGCAGAACCAGGCGCTGCGCCGTCAGATGCGTGGCGTCGCCCGGCAGG
TATCGATGAACCCCGATGAAGGGATGGATTTGTGA
 Primer design