SecReT4
Protein ID: 110636175
T4SS name [ID]Trb [271]
Gene symbol-
Locus tagMeso_3851
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]4153433..4154416 [+]
Producttype II secretion system protein E
Component typeTrbB
UniProt IDQ11BK7
KEGG IDmes:Meso_3851
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.5e-86, Aligned region: 25..290
FtsK_SpoIIIE [PF01580], Evalue: 1.1e-05, Aligned region: 136..176
Zeta_toxin [PF06414], Evalue: 2.3e-05, Aligned region: 147..216
TrwB_AAD_bind [PF10412], Evalue: 4e-05, Aligned region: 148..184
Protein Sequence: 327 a.a.     [Download]
>gi|110636175|ref|YP_676383.1| type II secretion system protein E [Chelativorans sp. BNC1]
MADFSRQSEATTRGARMLRTAMGPAIAGFLEDTRVVEVMLNPDGRLWVDRLAEGLADTGERLSPADGERI
IRLVAHHVGVEVHPRSPRVSAELPETGERFEGLLPPVVSSPAFAIRKPAVAIFTLDDYVAAGIMESGQAE
VLRMAVAARKNILVAGGTSTGKTTLTNALLAEMAKTEDRVVIIEDTRELQCSAPNLVAMRTKDGVATLSD
LVRSSLRFRPDRIPIGEVRGSEALDLLKAWGTGHPGGAGTIHAGSAIGALRRLEQLIQEAVVTVPRALIA
ETVDLIAVLSGRGAARRLSELSAVEGLGPDGDYRLKPATPSHDGDEI
 
Nucleotide Sequence: 984 bp     [Download]
>gi|110632362|ref|NC_008254.1|:4153433-4154416 Chelativorans sp. BNC1 chromosome, complete genome
ATGGCGGACTTCAGCCGGCAATCGGAAGCGACGACACGCGGGGCGCGGATGCTGCGCACGGCGATGGGTC
CGGCTATTGCCGGCTTCCTCGAAGACACCCGCGTCGTCGAAGTGATGCTCAATCCGGACGGACGCCTGTG
GGTCGACCGCCTGGCCGAGGGCCTCGCCGATACCGGAGAACGGCTCTCGCCCGCTGACGGCGAGCGCATC
ATCCGGCTGGTCGCGCATCACGTCGGTGTCGAGGTGCATCCGCGCTCGCCGCGCGTGTCGGCTGAGCTGC
CCGAGACCGGCGAGCGGTTCGAGGGCCTTTTGCCTCCCGTGGTCTCGTCGCCGGCTTTCGCCATCAGAAA
GCCGGCGGTCGCGATCTTCACGCTCGACGACTATGTGGCCGCCGGGATCATGGAAAGCGGTCAAGCCGAG
GTGCTGCGCATGGCGGTCGCCGCGCGCAAGAACATCCTCGTCGCCGGCGGCACCTCGACCGGAAAAACCA
CGCTCACCAATGCGCTGCTGGCCGAGATGGCCAAGACCGAGGATCGCGTCGTCATCATCGAGGACACGCG
CGAGCTTCAGTGCAGCGCTCCCAACCTCGTCGCCATGCGAACCAAGGACGGCGTGGCGACACTCTCGGAT
CTGGTGCGCTCGTCGCTCCGCTTTCGTCCGGACCGCATCCCGATCGGGGAAGTGCGCGGGAGCGAAGCGC
TGGACCTTCTGAAAGCGTGGGGGACCGGGCATCCCGGCGGGGCCGGCACTATTCACGCCGGCAGCGCCAT
CGGTGCGCTGCGTCGTCTCGAGCAGCTCATCCAGGAAGCCGTCGTCACCGTCCCCCGCGCTCTGATCGCC
GAGACGGTCGACCTGATCGCCGTGCTCTCCGGCAGGGGCGCCGCGCGCCGTCTCTCCGAGCTTTCCGCCG
TCGAGGGCCTTGGCCCGGATGGCGACTACCGCCTCAAGCCCGCAACACCCAGCCACGACGGAGACGAAAT
ATGA
 Primer design