SecReT4
Protein ID: 110636176
T4SS name [ID]Trb [271]
Gene symbol-
Locus tagMeso_3852
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]4154413..4154790 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ11BK6
KEGG IDmes:Meso_3852
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.7e-23, Aligned region: 30..114
Protein Sequence: 125 a.a.     [Download]
>gi|110636176|ref|YP_676384.1| conjugal transfer protein TrbC [Chelativorans sp. BNC1]
MIPERQPMRSARRLRSQPLCRCILGRLSSAGISVVTMLYALPAYAAGSSMPWEAPLESILESIEGPVAKI
IAVIIIIITGLTLAFGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALVG
 
Nucleotide Sequence: 378 bp     [Download]
>gi|110632362|ref|NC_008254.1|:4154413-4154790 Chelativorans sp. BNC1 chromosome, complete genome
ATGATCCCTGAACGACAGCCCATGCGGTCGGCACGCCGGCTGCGCAGTCAGCCCCTTTGTCGATGCATCC
TCGGCCGGCTCAGCAGCGCCGGAATCTCTGTCGTCACGATGCTCTATGCGCTCCCGGCCTATGCCGCTGG
CTCCTCGATGCCTTGGGAAGCGCCTCTGGAATCCATCCTCGAATCCATCGAGGGGCCGGTCGCCAAGATC
ATTGCAGTGATCATCATCATCATCACGGGCCTGACGCTCGCATTCGGCGACACCAGCGGCGGCTTTCGGA
GATTGATCCAGATCGTATTCGGTCTGTCGATTGCCTTCGCCGCGTCAAGCTTCTTCCTGTCCTTCTTCTC
GTTCGGCGGCGGGGCGCTGGTCGGATGA
 Primer design