SecReT4
Protein ID: 110636178
T4SS name [ID]Trb [271]
Gene symbol-
Locus tagMeso_3854
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]4155079..4157571 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDQ11BK4
KEGG IDmes:Meso_3854
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.4e-33, Aligned region: 442..714
CagE_TrbE_VirB [PF03135], Evalue: 7.7e-11, Aligned region: 182..388
Protein Sequence: 830 a.a.     [Download]
>gi|110636178|ref|YP_676386.1| conjugal transfer ATPase TrbE [Chelativorans sp. BNC1]
MLNLAEYRNRSTRLADYLPWAALVAPGVVLNKDGSFQRTARFRGPDLDSATPAELVGTTARLNNALRRLG
SGWAVFVEAQRVQATHYPDSQFPDAASALIDVERREQFEAEGVHFESRYFLTFLWMPPAEEASRAESWLY
EGKARTGVDPWELLAGFVDRTDRILQLVEGFVPEVDWLDDGETLTYLHSTVSTRRQRVRVPEAPMYLDAI
LVDEPLAGGLEPRLGEHHLRTLTVTGFPTATFPGILDELNRLAFEYRWSTRAILLDKTDATKLLTRIRRQ
WFAKRKSVAAIVKEVMTNEASTLLDSDAANKAFDADMALQELGSDDVGEAYVTATVTVWDRDPAIAVEKL
RLVEKIIQARDFTSIPETINAIEAWLGSLPGQPYANVRQPPVSTLNIAHMVPLSAVWAGPERNDHLGAPP
LLYGRTEGSTPFRFSLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYTNNQIFAFDFGGSIRIAALAMG
GDWHDLGGGLSDGADATVSLQPLARIHDVPERAWAADWIVSILGREGVQITPEVKEHLWSALTSLASAPV
DERTITGLSVLLQSNELKRALRPYCVGGPWGRLLDAEREHLGEGSVQAFETEGLVGTGAASAVLTYLFHR
IEGRLDGRPTLLIIDEGWLALDDENFADQLREWLKTLRKKNAAVIFATQSLSDIGDSAIAAAIVESCPTR
LFLPNERAIEPQILAIYRKFGLNDRQIEILARATPKRDYYCQSRRGNRLFELGLGDVALALCAASSKQHH
ARVDRVLATAGRDRFLEAWLGDCDLGWAADLIPDLPNIAGSEMAPADVPPPNQRPEEIDQ
 
Nucleotide Sequence: 2493 bp     [Download]
>gi|110632362|ref|NC_008254.1|:4155079-4157571 Chelativorans sp. BNC1 chromosome, complete genome
ATGCTGAACCTTGCCGAATACCGCAATCGGAGCACGCGCCTCGCGGACTATCTGCCTTGGGCTGCCCTCG
TAGCGCCGGGCGTCGTGCTCAACAAGGACGGCAGCTTCCAGCGCACGGCGCGCTTCCGCGGACCCGACCT
CGACTCGGCTACGCCGGCCGAGCTGGTCGGCACGACGGCCCGGCTCAACAATGCGCTGCGCCGACTCGGC
AGCGGGTGGGCCGTCTTCGTCGAGGCCCAGCGCGTCCAGGCAACGCACTATCCCGACAGCCAGTTTCCCG
ACGCAGCCTCCGCGCTGATCGACGTCGAGCGGCGCGAGCAGTTCGAAGCCGAAGGCGTCCATTTCGAAAG
CCGCTACTTCCTGACCTTTCTTTGGATGCCGCCCGCCGAGGAGGCAAGCCGCGCTGAAAGCTGGCTCTAC
GAGGGCAAGGCGCGCACGGGCGTCGATCCCTGGGAATTGCTCGCCGGCTTCGTCGATCGGACCGATCGTA
TCCTCCAGCTTGTCGAAGGTTTCGTGCCGGAGGTCGACTGGCTCGATGACGGCGAGACGCTGACCTATCT
GCATTCGACCGTCTCGACCCGGCGTCAGCGGGTGCGCGTGCCCGAAGCGCCGATGTATCTCGACGCGATT
CTGGTCGATGAGCCGCTGGCCGGCGGCCTCGAACCACGTCTGGGCGAACATCATCTGCGCACGCTCACCG
TCACCGGATTCCCCACCGCGACCTTCCCCGGCATCCTCGACGAGTTGAATCGGCTGGCGTTCGAGTATCG
CTGGTCCACGCGGGCAATCCTGCTGGACAAGACGGACGCGACCAAGCTCCTGACGCGCATCCGTCGCCAG
TGGTTCGCCAAGCGGAAGTCCGTCGCGGCCATTGTCAAAGAAGTCATGACCAATGAGGCATCGACGCTGC
TCGACAGCGACGCGGCCAACAAAGCGTTCGACGCGGACATGGCTTTGCAGGAGCTGGGCAGCGACGACGT
GGGCGAAGCCTATGTCACCGCCACTGTTACGGTTTGGGATCGCGATCCCGCAATCGCAGTCGAAAAGCTC
CGGCTGGTCGAGAAGATCATCCAGGCGCGAGATTTCACGTCGATCCCCGAAACCATCAACGCGATCGAAG
CGTGGCTCGGCTCGTTGCCTGGGCAGCCTTACGCCAATGTGCGGCAGCCGCCGGTCTCGACGCTCAACAT
CGCCCACATGGTGCCACTCTCGGCCGTGTGGGCGGGGCCGGAACGGAACGATCACCTCGGCGCGCCCCCG
CTGCTTTACGGCAGGACCGAGGGATCGACTCCGTTCCGGTTCTCCCTTCACGTCGGCGACGTAGGCCACA
CACTCGTCGTCGGCCCGACCGGCGCCGGCAAGTCCGTGCTGCTGGCGCTGATGGCGCTCCAGTTCCGCCG
CTACACGAACAACCAGATCTTCGCCTTCGATTTCGGCGGCTCCATCCGCATCGCAGCGCTCGCGATGGGC
GGCGATTGGCACGACCTGGGCGGCGGGCTCAGCGACGGCGCAGACGCGACCGTCTCGCTACAGCCCCTCG
CGCGCATCCATGATGTTCCCGAACGTGCTTGGGCAGCGGACTGGATCGTGTCGATCCTCGGCCGCGAGGG
CGTTCAGATCACCCCGGAGGTCAAGGAGCATCTATGGTCGGCGCTGACCTCGCTGGCCTCCGCGCCGGTC
GACGAGCGCACGATCACCGGACTTTCGGTGCTGCTGCAATCGAACGAATTGAAGCGTGCGCTGCGACCCT
ACTGTGTCGGCGGTCCCTGGGGTCGGTTGCTCGACGCCGAGCGCGAGCATCTCGGCGAGGGCTCGGTGCA
GGCTTTCGAGACCGAGGGTCTGGTCGGCACCGGCGCTGCATCTGCCGTGCTGACCTACCTCTTCCATCGC
ATCGAGGGTCGCCTGGACGGCCGGCCCACGCTCCTCATTATCGACGAGGGTTGGCTGGCGCTCGACGATG
AGAACTTCGCCGACCAGCTCCGCGAGTGGCTGAAGACGCTCAGAAAAAAGAACGCTGCCGTGATATTCGC
CACGCAGTCGCTTTCCGACATTGGCGACTCGGCGATTGCCGCCGCGATCGTCGAGAGCTGCCCGACGCGA
TTGTTCCTTCCCAACGAACGTGCAATCGAGCCGCAAATCCTCGCGATCTACCGCAAGTTCGGGCTCAACG
ACCGCCAGATCGAAATCCTCGCGCGGGCGACGCCCAAACGCGACTACTACTGCCAGAGCCGCCGCGGCAA
TCGCCTTTTCGAGCTTGGCCTGGGCGACGTTGCGCTCGCGCTCTGCGCCGCATCCTCCAAGCAGCATCAC
GCCCGTGTCGACCGTGTGCTGGCCACCGCCGGCCGTGACCGCTTTCTCGAAGCGTGGCTCGGTGACTGCG
ACCTTGGCTGGGCGGCCGACCTCATTCCCGACCTTCCCAACATTGCCGGCAGCGAGATGGCGCCGGCCGA
TGTGCCGCCCCCCAACCAGCGTCCAGAGGAGATCGACCAATGA
 Primer design