SecReT4
Protein ID: 110636179
T4SS name [ID]Trb [271]
Gene symbol-
Locus tagMeso_3855
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]4157568..4158329 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ11BK3
KEGG IDmes:Meso_3855
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 253 a.a.     [Download]
>gi|110636179|ref|YP_676387.1| conjugal transfer protein TrbJ [Chelativorans sp. BNC1]
MTRNSACRIVGVSAIAITLAAPLALAPVVSTPAHAQLFGFGRIVFDPTNYAENLLTAARSLEQINNQIQS
LQNEAQMLINQARNLASLPHSSLQQLQQAVSRTQQLLGEAQRIAFDVREIDQIFDNQYANVDLSMTDRQL
VDQARDRWGNTVGALQDAMRVQAGVVGNIDAQRTEMSALVGQSQNAVGALQATQAGNQLLALQAQQLADL
TAMLAANGRATALVDAERAAAAEQGRVQRQRFLTPGPGYQPGN
 
Nucleotide Sequence: 762 bp     [Download]
>gi|110632362|ref|NC_008254.1|:4157568-4158329 Chelativorans sp. BNC1 chromosome, complete genome
ATGACCCGAAATTCCGCCTGCCGGATCGTCGGCGTGAGCGCCATCGCCATCACACTTGCAGCCCCGCTTG
CACTTGCGCCGGTCGTTTCGACGCCGGCTCACGCGCAGCTCTTCGGCTTCGGCCGGATCGTCTTCGATCC
GACCAACTACGCCGAAAACCTTCTCACGGCGGCGCGCTCTCTTGAGCAGATCAACAACCAGATCCAGTCG
CTTCAGAACGAAGCGCAGATGCTCATCAACCAGGCCCGTAATCTTGCCAGCCTGCCGCACTCCTCGCTCC
AGCAGCTCCAGCAGGCTGTCTCGCGCACCCAGCAGCTTCTCGGCGAGGCGCAGCGTATCGCTTTCGACGT
CCGCGAGATCGACCAGATCTTCGACAATCAATACGCCAATGTCGATCTCTCGATGACGGACCGGCAGCTC
GTCGATCAGGCGCGAGATCGCTGGGGGAACACGGTCGGCGCGCTTCAGGACGCCATGAGGGTGCAGGCGG
GCGTCGTTGGCAATATCGACGCCCAGCGGACCGAGATGTCCGCCCTCGTCGGGCAGAGCCAGAACGCGGT
CGGCGCGCTTCAGGCGACCCAGGCCGGCAACCAGCTTCTCGCGCTTCAGGCGCAACAGCTCGCCGACCTC
ACCGCCATGCTCGCAGCCAACGGCCGTGCCACCGCTCTCGTCGATGCCGAACGCGCGGCTGCCGCCGAGC
AGGGGCGCGTCCAGCGGCAGCGGTTCCTCACCCCCGGCCCCGGCTACCAGCCGGGCAACTAG
 Primer design