SecReT4
Protein ID: 110636181
T4SS name [ID]Trb [271]
Gene symbol-
Locus tagMeso_3857
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]4158624..4159976 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ11BK1
KEGG IDmes:Meso_3857
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.1e-53, Aligned region: 37..262
Protein Sequence: 450 a.a.     [Download]
>gi|110636181|ref|YP_676389.1| conjugal transfer protein TrbL [Chelativorans sp. BNC1]
MEGAGVIDRFLQVFTTYIDSGFGLLGGEVAFIATTLIVIDVTLAALFWAWGADDDVLAKFIKKVIFVGVF
AYLISNWQTLAQIVFDSFAGLGLQASGTGFSTADLMRPGRVAQTGLDAGRPLLESISDLMGYWSFFENFL
QIICLLFAWALVLLAFFILSIQLFVTLIEFKLTTLAGFVLIPFGLFGQSAFMAERVLGNVVSSGIKVLVL
AVIIGIGSTLFGEFTAGFGGEQPTVDDAMAIVLAALSLLGLGIFGPGIANGIVSGGPQLGAGAAVGTGLA
VAGAGVAAGGGAMLAARGGAAALSGGAAVARGGAAAAGGAATAYSLGSAGQSGAAGVASGLGGVARAGGS
ATMAPVKRAVSRASESMRSSYAAGGRSAAAMTGGSSSMGTIGGEPEAAASSTTGGPPAWAQRMRRSQTMS
HGVSAAAHAVRSGDSHGGGASISLSQSDRT
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|110632362|ref|NC_008254.1|:4158624-4159976 Chelativorans sp. BNC1 chromosome, complete genome
ATGGAGGGCGCTGGCGTCATCGACCGCTTCTTGCAGGTCTTCACGACCTACATCGATTCCGGCTTCGGTC
TGCTCGGCGGTGAGGTGGCGTTCATTGCGACCACGCTCATCGTGATCGACGTGACGCTGGCCGCCCTGTT
CTGGGCATGGGGAGCTGATGACGACGTTCTCGCGAAGTTCATCAAAAAGGTCATTTTCGTCGGCGTGTTC
GCCTACCTGATCAGCAACTGGCAGACCCTCGCTCAGATCGTGTTCGACAGCTTCGCCGGCCTCGGGCTGC
AAGCCTCCGGCACGGGGTTTTCGACCGCGGACCTCATGCGGCCAGGTCGTGTCGCGCAGACCGGACTCGA
CGCCGGCCGTCCGCTGCTCGAATCCATCTCTGATCTCATGGGCTATTGGTCGTTCTTCGAGAACTTCCTG
CAAATCATCTGCCTGCTCTTCGCATGGGCACTCGTGCTGCTCGCTTTCTTCATCCTGTCGATCCAGCTCT
TCGTCACGCTGATCGAGTTCAAGCTGACGACGCTCGCCGGCTTCGTCCTCATCCCGTTCGGGCTATTTGG
GCAGAGTGCATTCATGGCCGAACGCGTTCTGGGCAACGTCGTCAGCTCCGGCATCAAAGTGTTGGTCCTC
GCCGTCATCATTGGCATCGGCTCGACACTCTTCGGTGAGTTCACGGCCGGCTTCGGCGGCGAGCAGCCGA
CCGTCGACGACGCGATGGCAATCGTGCTGGCGGCGCTCTCCCTTCTCGGCCTCGGCATTTTCGGGCCAGG
AATCGCGAACGGCATCGTCAGCGGCGGACCGCAGCTCGGTGCGGGCGCGGCCGTAGGGACCGGCCTTGCC
GTCGCCGGCGCAGGGGTCGCGGCAGGTGGCGGGGCGATGCTCGCCGCGCGCGGCGGGGCAGCCGCCCTCT
CTGGTGGCGCGGCCGTCGCACGTGGAGGAGCCGCCGCCGCAGGCGGCGCCGCGACGGCCTACTCGCTCGG
CTCGGCCGGACAAAGTGGAGCAGCCGGCGTCGCATCTGGCCTCGGCGGCGTCGCCCGCGCCGGCGGCAGC
GCCACGATGGCACCCGTGAAGCGCGCAGTATCCCGCGCCTCGGAGTCCATGCGCTCGTCCTACGCCGCCG
GCGGTCGGTCCGCGGCGGCCATGACCGGCGGCAGTTCCTCGATGGGAACGATCGGCGGTGAGCCCGAGGC
TGCCGCTTCCTCGACCACGGGAGGTCCGCCCGCCTGGGCCCAGCGCATGCGCCGCAGCCAGACGATGAGC
CATGGGGTCTCCGCCGCCGCCCATGCCGTCCGTTCCGGCGATAGCCACGGCGGCGGTGCTTCCATCAGCC
TTTCGCAGAGTGACCGCACATGA
 Primer design