SecReT4
Protein ID: 110636182
T4SS name [ID]Trb [271]
Gene symbol-
Locus tagMeso_3858
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]4159973..4160662 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ11BK0
KEGG IDmes:Meso_3858
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.4e-60, Aligned region: 23..226
Protein Sequence: 229 a.a.     [Download]
>gi|110636182|ref|YP_676390.1| conjugal transfer protein TrbF [Chelativorans sp. BNC1]
MNIFKRPMTRYGKTPEPETPYQRAGQAWDDRIGSARVQARNWRYMAFGCLILSAGFASALVWQSARGTVV
PWVVEIDSRGEARAVEPAVADYRPNDPQIAFHLARFIEQVRGLPADPIVVRQNWLRAYDFTTDRGAVALN
DYARANDPFTRVGRQQISVEVSSVIRASPDSFRVAWTERRFENGQLAGTERWTAILTIAIQAPRDAERLR
RNPLGVYVNAINWSRELGQ
 
Nucleotide Sequence: 690 bp     [Download]
>gi|110632362|ref|NC_008254.1|:4159973-4160662 Chelativorans sp. BNC1 chromosome, complete genome
ATGAACATCTTCAAGCGACCGATGACCCGCTACGGCAAGACGCCGGAACCGGAAACCCCTTATCAACGCG
CCGGCCAGGCATGGGACGACCGCATCGGCTCTGCCCGCGTGCAGGCCCGCAACTGGCGCTACATGGCCTT
TGGCTGCCTGATTCTGTCAGCGGGATTCGCCTCGGCTCTGGTCTGGCAGTCGGCACGCGGGACAGTGGTG
CCCTGGGTGGTCGAGATCGACAGCCGGGGAGAGGCCCGTGCGGTGGAACCCGCGGTCGCCGACTATCGCC
CCAACGACCCCCAGATCGCCTTCCACCTTGCCCGATTCATCGAGCAGGTTCGCGGCCTGCCTGCCGATCC
CATCGTCGTGCGGCAAAATTGGCTGCGCGCCTACGACTTCACGACCGACCGCGGCGCGGTCGCGCTCAAT
GACTATGCCCGCGCCAATGATCCGTTCACCCGTGTCGGCCGTCAGCAGATCAGTGTCGAGGTATCCAGCG
TCATCCGCGCTTCACCGGATTCGTTCCGCGTCGCGTGGACGGAGCGCCGCTTCGAGAACGGCCAGCTCGC
CGGCACCGAACGATGGACCGCGATCCTGACCATCGCGATCCAGGCGCCGCGGGATGCCGAGCGTCTGCGG
CGCAATCCCTTGGGAGTCTACGTCAATGCAATCAACTGGTCTCGGGAGCTGGGGCAATGA
 Primer design