SecReT4
Protein ID: 110636183
T4SS name [ID]Trb [271]
Gene symbol-
Locus tagMeso_3859
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]4160659..4161645 [+]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDQ11BJ9
KEGG IDmes:Meso_3859
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 6.7e-64, Aligned region: 105..321
Protein Sequence: 328 a.a.     [Download]
>gi|110636183|ref|YP_676391.1| conjugal transfer protein TrbG/VirB9/CagX [Chelativorans sp. BNC1]
MNDSTILAHGRKAVRASILLAALASATALTGCATAPRPPHITYDADVPPLPVVPAAVTDETPRPIHVPPA
WSPATGGTAASTPTARVENANLAARVEPRREGYYNAIQIYPWSEGALYQVYAAPGQITTIALEPGESLTG
AGPIAAGDTARWIIGDTESGSGPNRRVHVLVKPTRPDITTNLVVSTDRRVYLIELRSGENPYMPAVAWAY
PTPPASQRQTAPAAPIIPAVASRNYRYGLTGDAPPWRPISVYDDGRRVYIEFPRGIVQGEMPPIFVIGSD
GQPEIVNSRVHNNILIVDRLFGAAELRLGSGNRQQIVRIVRTDGRPTT
 
Nucleotide Sequence: 987 bp     [Download]
>gi|110632362|ref|NC_008254.1|:4160659-4161645 Chelativorans sp. BNC1 chromosome, complete genome
ATGAACGATTCGACCATACTCGCGCATGGGCGCAAGGCCGTCCGCGCCAGTATCCTCCTCGCAGCGCTGG
CATCGGCCACCGCGCTTACCGGCTGCGCAACGGCGCCGCGACCGCCGCACATCACCTACGATGCCGACGT
GCCCCCATTGCCCGTGGTGCCCGCCGCCGTCACCGACGAGACGCCCCGCCCAATCCACGTCCCGCCCGCC
TGGTCACCGGCGACGGGCGGGACAGCCGCCTCGACGCCGACGGCCCGCGTCGAAAACGCCAATCTCGCCG
CACGTGTCGAGCCTCGGCGTGAAGGCTACTACAATGCGATCCAGATTTATCCGTGGAGCGAAGGCGCGCT
CTATCAGGTCTACGCGGCTCCCGGCCAGATCACCACCATCGCGCTGGAGCCCGGCGAGAGCCTGACCGGC
GCCGGTCCGATCGCGGCGGGCGACACGGCGCGCTGGATAATTGGGGATACGGAAAGCGGCTCTGGCCCAA
ACCGCCGCGTGCATGTTCTGGTCAAGCCGACCCGGCCTGACATCACCACGAACCTTGTCGTCAGCACGGA
CCGACGCGTTTACCTGATCGAATTGCGCTCCGGCGAAAATCCCTACATGCCGGCAGTCGCCTGGGCCTAT
CCCACACCTCCGGCCTCGCAACGCCAGACCGCTCCCGCCGCACCGATCATCCCGGCTGTTGCGTCGCGCA
ACTACCGCTACGGCCTCACCGGCGATGCACCTCCGTGGCGTCCGATCTCGGTCTATGACGACGGCCGGAG
GGTCTATATAGAGTTCCCGCGCGGCATCGTGCAGGGCGAGATGCCGCCGATCTTCGTCATCGGCTCGGAC
GGTCAGCCAGAAATCGTCAATAGCCGCGTCCACAACAACATCCTGATCGTGGATCGCCTTTTCGGGGCGG
CCGAACTTCGGCTTGGCAGCGGCAATCGCCAGCAAATCGTGCGGATCGTCAGGACTGACGGGAGGCCGAC
GACATGA
 Primer design