SecReT4
Protein ID: 110636184
T4SS name [ID]Trb [271]
Gene symbol-
Locus tagMeso_3860
StrainChelativorans sp. BNC1
Repliconchromosome [GenBank: NC_008254] [Browse all T4SS(s) in this replicon]
Location [Strand]4161642..4162808 [+]
Productconjugation TrbI-like protein
Component typeTrbI
UniProt IDQ11BJ8
KEGG IDmes:Meso_3860
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.4e-61, Aligned region: 204..382
Protein Sequence: 388 a.a.     [Download]
>gi|110636184|ref|YP_676392.1| conjugation TrbI-like protein [Chelativorans sp. BNC1]
MTANETGKGEGIGAADTATTMRLRAEAPSVTRVSRKVLTGLGLIAGLGIGGALIYALQTADRQRQGEELF
TTDRRQTADGLQGLPSDYSGIPQLGPPLPGDLGGPIVRSREEGRPIPVETMPMPQADPEEQRRLAEMEAA
RTSQLFFQTRSDTSSGLPSFQPNFGGATSPTGSGSQDRHLTFLNAEVDRRTVAPDRVAAPASPYVLQAGS
VIPAALITGIRSDLPGQITAQVTQHVYDSPTGSLVLIPQGTRIIGEYDAGVTFGQRRILLVWNRLIFPNG
RSIVLERQPGVDTQGYAGLEDQVDYHWWDLAKAAGLSTLLAIGTNMAMSDEDRLIQAIRRGAGDTVNDAG
QQIIQRQLQVAPTLTIRPGFPMRVVVTRDLVLEPYAAH
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|110632362|ref|NC_008254.1|:4161642-4162808 Chelativorans sp. BNC1 chromosome, complete genome
ATGACCGCCAACGAGACCGGAAAGGGAGAGGGGATCGGCGCGGCCGACACGGCAACGACCATGCGGCTGC
GGGCGGAGGCGCCAAGCGTCACCCGCGTCTCGCGCAAGGTGCTGACCGGGCTCGGCCTCATTGCCGGCCT
CGGCATCGGCGGTGCGCTGATCTATGCGCTCCAGACCGCCGATCGGCAGCGGCAAGGCGAGGAGCTGTTC
ACCACCGACCGCCGCCAAACGGCCGATGGTTTGCAGGGGCTGCCGTCCGACTACAGCGGCATCCCACAAT
TGGGACCACCACTTCCGGGCGATCTGGGAGGACCGATCGTGCGCTCCCGTGAGGAAGGCCGGCCCATTCC
GGTAGAGACCATGCCGATGCCGCAGGCTGACCCGGAGGAGCAGCGGCGGCTTGCGGAGATGGAGGCCGCA
CGCACCAGCCAGCTCTTTTTTCAGACCCGCTCGGACACCAGCTCCGGCCTGCCATCCTTCCAGCCGAACT
TCGGCGGCGCGACTAGCCCGACAGGTTCCGGGAGCCAGGACAGGCATCTGACCTTCCTCAACGCCGAGGT
CGACCGGCGAACGGTGGCGCCGGATCGCGTCGCTGCACCAGCCTCGCCCTACGTTCTTCAGGCCGGATCG
GTGATCCCGGCGGCCCTCATCACCGGCATTCGATCGGACCTGCCTGGGCAGATCACAGCACAGGTCACCC
AACACGTCTACGACTCCCCCACCGGAAGCCTTGTCCTGATTCCGCAGGGGACCCGGATCATCGGGGAGTA
CGACGCCGGTGTCACATTCGGTCAGCGCCGGATTTTGCTGGTGTGGAATCGCCTGATCTTCCCGAACGGA
CGCTCCATCGTCCTCGAAAGGCAGCCGGGCGTCGATACCCAGGGCTATGCGGGCCTCGAAGATCAGGTCG
ACTATCATTGGTGGGACCTGGCCAAGGCCGCTGGTCTTTCAACGCTGCTTGCGATCGGCACAAACATGGC
CATGAGCGACGAGGACAGGCTTATCCAGGCGATCCGCCGGGGCGCTGGCGACACGGTCAACGACGCGGGC
CAGCAGATCATCCAGCGACAATTGCAGGTCGCCCCGACCCTCACAATCCGTCCGGGGTTCCCGATGCGCG
TCGTCGTTACTCGCGACCTCGTTCTCGAGCCCTACGCCGCACACTGA
 Primer design