SecReT4
Protein ID: 111038057
T4SS name [ID]Trb [74]
Gene symboltrbC
Locus tagpKJK5_5
StrainIncP-1 plasmid pKJK5
Repliconplasmid pKJK5 [GenBank: NC_008272] [Browse all T4SS(s) in this replicon]
Location [Strand]4683..5147 [+]
Productputative prepilin
Component typeTrbC
UniProt IDQ0VUW9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 9.1e-19, Aligned region: 18..110
Protein Sequence: 154 a.a.     [Download]
>gi|111038057|ref|YP_709144.1| putative prepilin [uncultured bacterium]
MQALFPSFRLDQRTMFYVGLALVLAFLLLAPQHAFASEGTGGSLPYESWLTNLRNSVTGPVAFALSIIGI
VVAGGILIFGGELNGFFRTLIFIVLVMALLVGAQNMMSTFFGRGAEIAALTDGALHQVKVAALDVAGFSG
DVVTRWAERGYVAG
 
Nucleotide Sequence: 465 bp     [Download]
>gi|111038052|ref|NC_008272.1|:4683-5147 Uncultured bacterium IncP-1 plasmid pKJK5 complete sequence
ATGCAAGCACTCTTCCCGTCATTCAGGCTCGACCAGCGCACGATGTTTTATGTCGGCCTGGCTCTTGTCC
TGGCGTTCCTTCTGCTGGCTCCCCAGCACGCTTTCGCCTCGGAAGGCACCGGCGGTTCGTTGCCGTATGA
AAGCTGGCTGACGAACTTGCGGAACTCTGTCACCGGCCCGGTCGCGTTCGCGCTGTCGATCATCGGCATC
GTGGTCGCCGGCGGCATCTTGATCTTCGGCGGCGAACTCAACGGCTTCTTCCGCACGTTGATCTTCATCG
TCCTGGTCATGGCTCTGCTGGTCGGTGCGCAAAACATGATGAGCACCTTCTTTGGTCGTGGCGCGGAAAT
CGCAGCCCTGACCGATGGGGCGCTGCACCAGGTCAAGGTCGCCGCGCTGGACGTGGCGGGCTTCTCCGGC
GACGTGGTGACGCGCTGGGCCGAACGCGGCTACGTGGCGGGGTAA
 Primer design