SecReT4
Protein ID: 111038061
T4SS name [ID]Trb [74]
Gene symboltrbG
Locus tagpKJK5_9
StrainIncP-1 plasmid pKJK5
Repliconplasmid pKJK5 [GenBank: NC_008272] [Browse all T4SS(s) in this replicon]
Location [Strand]8805..9698 [+]
ProductTrbG protein
Component typeTrbG
UniProt IDQ0VUW5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.2e-65, Aligned region: 71..295
Protein Sequence: 297 a.a.     [Download]
>gi|111038061|ref|YP_709148.1| TrbG protein [uncultured bacterium]
MNKTIFAVLLGASLTIPTVALAADDLADKFFSNNNPTLTPQEQAAIAIAKRWEAGSATGMKPVAGSNGAI
KFLYGAQQPSIVCAVLQVCDVALQAGEQVNSINLGDTARWTVEPAITGSGAGEVQHLIIKPMDVGLETSL
VVTTNRRTYHFRLRSHRTQYMPQVSFTYPEDALAKWDAIKAREVQHRTDNTIPSTGEYLGDLSFDYTLSG
SASWKPVRVFNDGRKTIIQMPRSMEQTEAPTLLVVRRDGGLFRDAETVMVNYRVQGDRYIVDTVFDKAIL
IAGVGSGQDRVTITRGK
 
Nucleotide Sequence: 894 bp     [Download]
>gi|111038052|ref|NC_008272.1|:8805-9698 Uncultured bacterium IncP-1 plasmid pKJK5 complete sequence
ATGAACAAAACCATCTTTGCTGTGCTGTTGGGCGCTTCGCTGACGATCCCGACCGTGGCCCTGGCCGCCG
ATGACCTGGCCGACAAGTTTTTCTCCAACAACAACCCGACCCTGACCCCGCAGGAACAGGCGGCCATTGC
CATCGCCAAGCGGTGGGAAGCTGGATCGGCCACCGGCATGAAGCCGGTAGCCGGCTCCAATGGCGCGATC
AAGTTCCTGTACGGGGCGCAGCAGCCCAGCATCGTTTGCGCGGTGCTCCAGGTGTGCGACGTGGCCTTGC
AAGCCGGCGAGCAAGTCAACTCGATCAACCTGGGCGACACGGCCCGCTGGACGGTCGAGCCGGCCATTAC
CGGCAGCGGTGCGGGCGAAGTCCAGCACCTCATCATCAAGCCGATGGACGTGGGCCTGGAAACCAGCCTG
GTCGTGACGACGAACCGCCGTACCTATCACTTCCGGCTGCGCTCGCATCGCACGCAATACATGCCGCAAG
TGTCCTTCACGTATCCCGAGGACGCGCTTGCGAAGTGGGACGCGATCAAGGCCCGCGAAGTGCAGCACCG
CACCGATAACACCATCCCTTCCACTGGCGAGTACCTGGGCGACCTGTCGTTTGATTACACGCTGTCCGGC
TCGGCTTCCTGGAAGCCTGTGCGCGTGTTCAACGATGGCCGCAAGACCATCATTCAGATGCCGCGCTCGA
TGGAGCAAACCGAAGCGCCGACTCTGCTTGTTGTGCGTCGTGACGGCGGCCTGTTCCGTGATGCTGAAAC
CGTGATGGTCAATTACCGCGTCCAGGGCGACCGCTACATCGTGGATACGGTGTTCGACAAGGCAATCCTG
ATTGCCGGCGTCGGCAGCGGGCAAGACCGCGTGACCATTACAAGGGGGAAATAA
 Primer design