SecReT4
Protein ID: 111038067
T4SS name [ID]Trb [74]
Gene symboltrbL
Locus tagpKJK5_15
StrainIncP-1 plasmid pKJK5
Repliconplasmid pKJK5 [GenBank: NC_008272] [Browse all T4SS(s) in this replicon]
Location [Strand]12759..14675 [+]
ProductTrbL protein
Component typeTrbL
UniProt IDQ0VUV9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7e-41, Aligned region: 67..291
Protein Sequence: 638 a.a.     [Download]
>gi|111038067|ref|YP_709154.1| TrbL protein [uncultured bacterium]
MKNRSAWFAIAAAVVVLLIAAPDAFAGTPGNANVGFYDDILRRFQSAATGWQSVITNAASWLFWTLVVIS
MVWTFGMMALRKADIGEFFAEFVRFTIFTGFFWWLLINGPNFAVSIMQSLSQLGASAGGLPSTPGQLGIT
PSGIVDIGFKIFGQIIDNMSFWPNKFHLSLMGGLMGLGILVMLCLIGINMLLLLVSAWFLAYAGIFFLGF
GGSRWTSDMAINYYKTVLGLAVQILAMVLLIAIGKTFLDQYYATLQADISATNLKSMAALLMACVVLLAL
TSRIPPLLAGIITGAAVGGGGVGSMVGAGTLAAAAGMAGAAVATGGAALAAGGAAAAGGAQAVMAAFSKA
SENASSGGGGGDLMSAFSGGGGDDGGGGGGGGDEAGTGDTPFAQAAGFGGGGGDGGGGGGDTSTGGGADS
SGGDGGGKSGGGKAASGDKTASAGGAQSSGGGKSGGGTSSSSGDDTGGASSGGGAAAAAGGGFLASAAKA
GRITADAGGILAKAAGSVAKAKAAGIKDSAMARIAETTGGKMAAAIKASGAGAASGGDAGAGAAPSAGSE
FTGNNLGGDGGGGDGWINQTGGFSELSEADQAQAMESHAEWQAKSEGNTFGVEDYVSYVQERQQERNAEA
ASFVNKKA
 
Nucleotide Sequence: 1917 bp     [Download]
>gi|111038052|ref|NC_008272.1|:12759-14675 Uncultured bacterium IncP-1 plasmid pKJK5 complete sequence
ATGAAAAATCGCAGTGCATGGTTTGCGATAGCGGCGGCGGTCGTCGTTCTGCTTATCGCGGCCCCCGATG
CTTTTGCAGGCACACCGGGCAATGCCAACGTCGGCTTCTACGACGACATTTTGCGGCGGTTCCAAAGCGC
GGCCACTGGCTGGCAGTCCGTCATCACTAACGCCGCTTCCTGGCTGTTCTGGACGCTGGTTGTGATTTCG
ATGGTCTGGACGTTCGGCATGATGGCCTTGCGCAAGGCCGACATTGGCGAGTTCTTCGCGGAGTTCGTCC
GGTTCACGATCTTCACCGGCTTTTTCTGGTGGCTGCTCATCAACGGCCCCAACTTCGCCGTGTCGATCAT
GCAATCGCTTTCCCAGCTCGGCGCGTCGGCCGGGGGCCTGCCATCCACACCGGGCCAGCTCGGCATCACG
CCTTCTGGAATCGTGGATATTGGCTTTAAGATTTTCGGGCAGATTATCGACAATATGTCGTTCTGGCCTA
ACAAGTTCCACCTGAGCCTTATGGGTGGCCTCATGGGCTTGGGCATCCTGGTCATGCTGTGCCTTATCGG
CATCAACATGCTGTTGCTCCTGGTGTCGGCCTGGTTTCTTGCGTATGCCGGCATCTTCTTCCTTGGCTTT
GGTGGATCGCGTTGGACTTCCGACATGGCGATCAACTACTACAAGACCGTGCTGGGCCTGGCCGTCCAGA
TTCTGGCAATGGTGCTTCTGATTGCCATCGGCAAGACCTTCCTTGACCAGTATTACGCGACCCTCCAAGC
CGACATTAGCGCCACGAACCTGAAATCAATGGCCGCGCTCTTGATGGCGTGCGTTGTTCTCCTGGCGTTG
ACCTCTCGGATTCCTCCGCTTCTTGCTGGAATCATCACTGGCGCGGCCGTAGGCGGCGGCGGTGTTGGCA
GCATGGTCGGTGCTGGCACGCTTGCAGCGGCCGCAGGTATGGCCGGCGCGGCCGTAGCGACTGGCGGCGC
GGCTCTGGCCGCCGGCGGGGCAGCAGCAGCGGGCGGGGCGCAGGCAGTTATGGCGGCGTTCTCCAAGGCC
AGCGAAAACGCCTCAAGCGGCGGCGGTGGCGGCGATCTTATGTCGGCGTTCAGTGGTGGCGGTGGCGATG
ACGGCGGCGGCGGTGGCGGTGGCGGCGATGAAGCTGGCACCGGCGACACGCCCTTTGCTCAAGCCGCCGG
CTTTGGTGGCGGTGGCGGTGACGGCGGCGGTGGCGGTGGTGACACCAGCACCGGCGGCGGTGCCGATTCG
TCGGGCGGCGATGGCGGCGGCAAGTCCGGCGGCGGCAAAGCAGCCAGCGGCGACAAGACGGCCAGCGCCG
GCGGCGCGCAATCGTCGGGTGGCGGCAAGTCCGGCGGCGGTACTTCGTCCAGCTCGGGCGACGACACTGG
CGGCGCATCGAGCGGCGGCGGTGCTGCCGCAGCAGCGGGCGGTGGATTCCTGGCCTCGGCCGCCAAGGCC
GGCCGGATCACGGCGGACGCGGGCGGCATCTTGGCCAAGGCCGCCGGATCGGTGGCCAAGGCCAAAGCGG
CCGGCATCAAGGATTCGGCAATGGCTCGTATCGCTGAAACAACCGGCGGCAAGATGGCCGCAGCAATCAA
GGCCAGCGGGGCAGGGGCGGCGTCCGGTGGCGATGCCGGCGCGGGCGCAGCTCCAAGTGCTGGCAGCGAG
TTCACCGGCAACAACCTTGGCGGCGACGGCGGCGGCGGCGATGGCTGGATCAACCAAACCGGCGGATTCA
GCGAGCTATCGGAAGCCGACCAGGCGCAGGCAATGGAGTCCCATGCCGAATGGCAGGCCAAGAGTGAAGG
CAATACGTTCGGTGTCGAGGACTACGTTTCGTATGTCCAGGAGCGGCAGCAGGAGCGGAATGCCGAAGCC
GCTAGTTTCGTCAACAAAAAGGCGTGA
 Primer design