SecReT4
Protein ID: 113461884
T4SS name [ID]Tfc [676]
Gene symbol-
Locus tagHS_1748
StrainHaemophilus somnus 129PT
Repliconchromosome [GenBank: NC_008309] [Browse all T4SS(s) in this replicon]
Location [Strand]1975087..1975857 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDQ0I5S1
KEGG IDhso:HS_1748
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 256 a.a.     [Download]
>gi|113461884|ref|YP_719953.1| hypothetical protein HS_1748 [Haemophilus somnus 129PT]
MVAVCERQNACCVPNSTGWTMAITRLLVAVFLLNACTLSVQAFSFGQDIDQDIHNAAQHYQVSEEMLRGL
VKMEDGWYGKGSPTGALGVGQFTQKTWNWLAQTVRGQALGMQLITPSNRGTKSDPRHHHRTNTYATALLA
RWHLEQFALRGIKPTDVHLYLAHNIGLEGLHRAILGRANAEDIRNMRLNGMRHGMSVAQFLAYQGQRYRL
HKHIANNRIHLNEQNYAWVTPKSAVKNQAIFWIDPQSTPLVWVDPK
 
Nucleotide Sequence: 771 bp     [Download]
>gi|113460149|ref|NC_008309.1|:1975087-1975857 Haemophilus somnus 129PT chromosome, complete genome
TTGGTTGCAGTATGCGAAAGGCAAAATGCCTGCTGCGTTCCAAATTCAACAGGATGGACAATGGCAATCA
CTCGTTTATTAGTGGCTGTTTTTCTATTGAATGCCTGTACGCTTTCGGTACAGGCGTTTAGCTTTGGTCA
AGACATCGATCAAGATATTCATAATGCAGCACAACATTATCAAGTGAGTGAGGAGATGTTAAGAGGTTTG
GTGAAGATGGAAGATGGCTGGTATGGAAAAGGTTCGCCAACAGGGGCATTGGGTGTAGGACAATTTACGC
AAAAAACCTGGAATTGGTTAGCACAAACAGTACGAGGACAAGCATTAGGTATGCAACTAATTACCCCCTC
AAATCGTGGCACAAAATCCGATCCGCGGCATCATCATCGCACAAATACCTATGCTACCGCTTTATTAGCC
CGTTGGCATTTAGAACAGTTTGCACTACGAGGCATTAAGCCAACTGATGTTCATCTCTATCTTGCCCATA
ATATTGGTTTAGAGGGATTGCATCGTGCAATATTGGGGCGTGCGAATGCTGAAGATATTCGTAATATGCG
TCTCAATGGTATGCGTCATGGCATGTCGGTTGCACAATTTCTTGCGTATCAAGGACAGCGTTATCGACTG
CACAAACACATCGCCAATAACCGAATCCATTTAAATGAACAAAACTATGCTTGGGTTACACCTAAAAGTG
CGGTGAAAAATCAGGCTATTTTTTGGATTGACCCACAAAGTACACCGCTTGTTTGGGTTGATCCAAAATA
A
 Primer design