SecReT4
Protein ID: 113461889
T4SS name [ID]Tfc [676]
Gene symbol-
Locus tagHS_1753
StrainHaemophilus somnus 129PT
Repliconchromosome [GenBank: NC_008309] [Browse all T4SS(s) in this replicon]
Location [Strand]1979230..1979919 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDQ0I5R6
KEGG IDhso:HS_1753
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 4.6e-64, Aligned region: 39..226
Protein Sequence: 229 a.a.     [Download]
>gi|113461889|ref|YP_719958.1| hypothetical protein HS_1753 [Haemophilus somnus 129PT]
MTGQTNQKVKKKGLLYTLSALLATLFLSLLLSILLEWLGIAFIWSEQGHLHSQAMMIQELGWISESTTRS
LFGYSPSELANTITLTLHDWLFVKTGFQPWLHSPSKHSDWEYLIYHYTRAYLESIIYVLITFVVRLIVII
FTSPLFLLAAFAGFTEGLMIRDLRKFGSGRESSFLYHHARRYIKPVMIGSWILYLSIPVSVYPNIILIPA
AFLFGLSICITVASFKKYL
 
Nucleotide Sequence: 690 bp     [Download]
>gi|113460149|ref|NC_008309.1|:1979230-1979919 Haemophilus somnus 129PT chromosome, complete genome
ATGACCGGACAGACGAATCAAAAAGTCAAGAAAAAAGGGCTGCTCTACACATTATCTGCCTTGCTTGCTA
CACTGTTTCTTTCTCTATTGCTGAGTATTCTCCTTGAATGGTTAGGGATTGCCTTTATTTGGTCTGAACA
AGGTCATTTGCATAGCCAAGCGATGATGATTCAGGAATTAGGTTGGATTTCAGAAAGTACAACACGCAGC
CTCTTTGGTTATTCACCAAGTGAGCTTGCCAATACTATCACCCTTACTTTGCATGATTGGCTGTTTGTGA
AAACAGGGTTTCAACCTTGGTTACACTCGCCCAGCAAACACAGTGATTGGGAATATCTGATTTACCATTA
TACACGAGCGTATTTAGAGTCAATCATTTATGTATTGATTACTTTTGTAGTGCGGCTGATTGTAATCATT
TTTACCAGTCCTTTGTTTTTATTAGCCGCCTTTGCGGGGTTTACGGAGGGCTTAATGATACGTGATTTAC
GTAAATTTGGTTCTGGAAGAGAGTCAAGTTTTTTATATCATCATGCAAGACGCTATATTAAACCCGTGAT
GATAGGTTCTTGGATTCTTTACCTGTCCATTCCTGTTTCAGTTTACCCGAATATCATTTTAATACCTGCC
GCATTTTTATTTGGGCTGTCTATTTGCATTACCGTAGCGAGCTTTAAAAAATACTTATAA
 Primer design