SecReT4
Protein ID: 113461892
T4SS name [ID]Tfc [676]
Gene symbol-
Locus tagHS_1756
StrainHaemophilus somnus 129PT
Repliconchromosome [GenBank: NC_008309] [Browse all T4SS(s) in this replicon]
Location [Strand]1981051..1981374 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDQ0I5R3
KEGG IDhso:HS_1756
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 3.9e-28, Aligned region: 19..102
Protein Sequence: 107 a.a.     [Download]
>gi|113461892|ref|YP_719961.1| hypothetical protein HS_1756 [Haemophilus somnus 129PT]
MSMNTSGKKVLFAVSMSMMALAVQASEKAQLAQAIKQLEAAQLSLKRAEAVAQTSEKNREYFDYQAARRD
INAIKSGINQYINPARAIPRDPNASRRLQEDYTKLRH
 
Nucleotide Sequence: 324 bp     [Download]
>gi|113460149|ref|NC_008309.1|:1981051-1981374 Haemophilus somnus 129PT chromosome, complete genome
TTGTCGATGAATACGTCAGGAAAAAAGGTTTTATTCGCGGTCTCTATGTCTATGATGGCATTAGCTGTAC
AAGCCTCAGAAAAAGCACAGTTAGCCCAAGCTATCAAACAGCTTGAAGCCGCTCAACTTTCGCTTAAGCG
AGCGGAGGCAGTTGCTCAGACCTCGGAGAAAAACCGTGAATATTTTGATTATCAGGCTGCTCGTCGAGAT
ATTAATGCGATTAAAAGTGGTATTAATCAATATATCAATCCGGCACGTGCCATTCCTCGCGATCCCAATG
CTTCTCGTCGCTTGCAAGAAGACTACACCAAATTAAGACATTAA
 Primer design