SecReT4
Protein ID: 113461895
T4SS name [ID]Tfc [676]
Gene symbol-
Locus tagHS_1759
StrainHaemophilus somnus 129PT
Repliconchromosome [GenBank: NC_008309] [Browse all T4SS(s) in this replicon]
Location [Strand]1982089..1982457 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDQ0I5R0
KEGG IDhso:HS_1759
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 4e-40, Aligned region: 5..117
PHO4 [PF01384], Evalue: 4.1e-05, Aligned region: 32..81
Protein Sequence: 122 a.a.     [Download]
>gi|113461895|ref|YP_719964.1| hypothetical protein HS_1759 [Haemophilus somnus 129PT]
MSNQEEIQFLPTRLNREATVYGGMTVPEFGIAATIGFAMGLVFGLVLWAIGLSWILAPALAMLMCIIFVL
IGKVLFARLKRGKPEAYLNRLIEERMDSLLGGNKFIRRGGFWVTRRSSRGLF
 
Nucleotide Sequence: 369 bp     [Download]
>gi|113460149|ref|NC_008309.1|:1982089-1982457 Haemophilus somnus 129PT chromosome, complete genome
ATGTCAAATCAAGAAGAGATTCAATTTTTACCCACTCGACTTAATCGAGAAGCTACCGTGTACGGTGGTA
TGACGGTGCCTGAATTTGGGATTGCAGCTACAATTGGATTTGCGATGGGACTAGTTTTTGGGCTTGTACT
GTGGGCGATTGGACTATCTTGGATTCTCGCTCCCGCTCTTGCGATGTTAATGTGCATTATTTTTGTGCTG
ATTGGCAAAGTATTGTTTGCACGCTTAAAACGGGGCAAACCGGAAGCTTATTTAAACCGTCTGATTGAAG
AACGCATGGATTCGCTTTTAGGCGGCAATAAATTTATTCGACGTGGTGGCTTTTGGGTCACTCGTCGTTC
TTCAAGAGGACTGTTTTAG
 Primer design