SecReT4
Protein ID: 113461910
T4SS name [ID]Tfc [676]
Gene symbol-
Locus tagHS_1774
StrainHaemophilus somnus 129PT
Repliconchromosome [GenBank: NC_008309] [Browse all T4SS(s) in this replicon]
Location [Strand]1993321..1995321 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDQ0I5P5
KEGG IDhso:HS_1774
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 666 a.a.     [Download]
>gi|113461910|ref|YP_719979.1| hypothetical protein HS_1774 [Haemophilus somnus 129PT]
MKRLNKVSIAILFALTTSPIYAETSLLDNLQFNKSDSVLSDQIYYQIGGGSGYMTPPTRAKSLKAIEFGI
GWKANLMCGNFDIKTTVKNQLNGITEGFKDLMSNVIESAKGAVASLPAMVIQRANPQLYDILTNGVYQGR
LDFNRLKTSCEAMSKQLADYTLNGRWAKSADLENYKDIVATEPDAQKAQKKSEDNKGKNGKEWIGGQKRG
GEKQEQIKLIKDVSEAGYNLLHNRNALDKKPLLGPSCTGATCQIFDSPQKLSDFLTRTIGEQSISTCIED
CGPKTSSKAGVGLAPAIEEENLRTVEKLEQVLNMDTPSKEILAELSSNTIPVTRGLIEALREDPDVELLS
QRLGAEIATAKVMEKMLLARRAILAGMREPYVAADKNAQEELEKALNKIDLEISQVKLEMDMQKMLTSNT
ASVVIQNKLNREANVGNHGESYDNVDKRVNDLAYGSPNAEEHMEASDISLPSRNIALDIPTVSNTAPYRP
SYNTGTQVGRYSGSYNPIAPINGSSLDQATGLLRKFEGFISKADWDVNAHRVGYGSDTITKADGTVIKVQ
PGMTVTREDAERDLARRTQLYTNQIKREISEQTWNGLSDRAQAVLTSYIYNYGTLNKTKSVISAAQASAQ
SGDMTALANAIRRRQVDNKGVNARRRNQEADYILGK
 
Nucleotide Sequence: 2001 bp     [Download]
>gi|113460149|ref|NC_008309.1|:c1995321-1993321 Haemophilus somnus 129PT chromosome, complete genome
ATGAAACGACTCAATAAAGTGAGTATTGCTATACTTTTCGCACTCACTACTTCCCCCATTTATGCAGAGA
CTTCTCTGTTAGATAACCTTCAATTCAACAAATCAGACTCTGTGTTATCCGATCAAATTTACTATCAAAT
CGGTGGGGGCTCAGGCTATATGACACCACCGACACGGGCAAAATCCCTCAAAGCCATTGAATTTGGGATT
GGTTGGAAAGCCAATTTAATGTGCGGTAATTTTGACATTAAAACCACCGTAAAAAATCAATTAAATGGTA
TCACGGAGGGATTTAAAGATTTAATGAGCAATGTGATAGAATCGGCAAAAGGTGCGGTAGCCAGTCTTCC
TGCTATGGTTATTCAACGTGCTAACCCGCAACTTTATGACATTTTGACTAATGGAGTGTATCAGGGGCGG
CTTGATTTTAATCGTCTAAAAACCAGTTGTGAGGCTATGTCGAAACAACTCGCTGACTATACGCTAAATG
GGCGTTGGGCAAAATCGGCGGATTTGGAAAACTATAAAGACATTGTGGCCACTGAACCCGATGCACAAAA
AGCACAGAAAAAATCGGAAGATAACAAAGGAAAAAATGGTAAGGAATGGATTGGCGGTCAAAAACGTGGC
GGTGAAAAGCAAGAACAAATCAAACTGATTAAAGATGTTTCAGAAGCAGGTTACAACCTCTTACATAACC
GCAACGCCTTGGACAAAAAACCACTTCTAGGGCCATCTTGTACCGGGGCAACCTGCCAAATATTCGATTC
GCCACAAAAACTCTCCGACTTTTTAACCCGAACTATTGGAGAACAATCTATTTCTACCTGTATTGAAGAC
TGTGGTCCGAAAACCAGCTCAAAAGCGGGGGTCGGACTCGCTCCTGCGATTGAAGAAGAAAATCTGCGAA
CCGTAGAGAAACTTGAACAAGTGCTGAATATGGACACGCCAAGTAAAGAAATACTGGCTGAACTGAGTTC
GAATACCATTCCTGTTACACGGGGACTGATTGAAGCTTTACGTGAAGATCCTGACGTGGAACTGCTTAGC
CAACGTTTGGGTGCCGAAATCGCTACAGCTAAAGTCATGGAAAAAATGCTATTGGCTCGCCGAGCAATAC
TTGCCGGAATGCGAGAACCCTATGTGGCTGCCGATAAAAATGCACAGGAGGAGCTGGAAAAAGCTTTAAA
TAAAATTGACTTGGAAATCTCTCAAGTCAAACTTGAAATGGATATGCAAAAAATGCTCACCAGTAATACA
GCATCTGTCGTGATTCAAAATAAACTCAACCGTGAAGCCAATGTGGGGAACCATGGAGAAAGCTATGACA
ACGTGGATAAACGAGTCAATGACTTAGCTTACGGCTCACCAAATGCAGAAGAGCATATGGAAGCGAGCGA
TATTTCCTTACCTAGCCGAAACATCGCCCTAGATATTCCAACAGTGAGTAATACTGCTCCTTATAGACCG
TCTTATAATACAGGCACTCAAGTGGGAAGGTATTCGGGCAGCTATAATCCCATTGCACCAATTAATGGTT
CTTCACTCGACCAAGCTACGGGATTATTAAGAAAATTTGAAGGATTTATTAGCAAAGCGGATTGGGATGT
AAACGCCCATCGTGTAGGCTACGGTTCAGATACCATTACTAAAGCTGACGGCACGGTGATCAAAGTACAA
CCCGGAATGACCGTAACCAGAGAAGATGCTGAGCGTGATTTAGCTCGAAGAACCCAACTCTACACGAACC
AAATCAAACGAGAGATTTCAGAACAAACGTGGAATGGTTTATCTGATCGTGCTCAAGCTGTATTAACCTC
TTATATTTATAACTACGGCACGTTAAATAAGACCAAAAGTGTCATTAGTGCTGCACAAGCCTCAGCACAA
TCAGGAGATATGACCGCATTGGCCAATGCAATTAGAAGACGTCAAGTGGACAATAAAGGCGTCAATGCAA
GACGCCGAAATCAAGAAGCCGATTACATTCTAGGCAAATAG
 Primer design