SecReT4
Protein ID: 113473799
T4SS name [ID]Tra_F [517]
Gene symboltraL
Locus tagpCAR3_121
StrainSphingomonas sp. KA1 plasmid pCAR3 (NC_008308)
Repliconplasmid pCAR3 [GenBank: NC_008308] [Browse all T4SS(s) in this replicon]
Location [Strand]123109..123393 [+]
Productsex pilus assembly and synthesis protein
Component typeTraL_F
UniProt IDQ0KJJ2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.9e-37, Aligned region: 2..93
Protein Sequence: 94 a.a.     [Download]
>gi|113473799|ref|YP_718062.1| sex pilus assembly and synthesis protein [Sphingomonas sp. KA1]
MQRYTVPAHLDDPELIGFWTLDEFIAMIVPFAWGVLSQHILIGLLTSVLAWWGLRKLKAGRAVSWIIHTA
YWYLPGSFMGLKATPPSHLRVMAG
 
Nucleotide Sequence: 285 bp     [Download]
>gi|113473678|ref|NC_008308.1|:123109-123393 Sphingomonas sp. KA1 plasmid pCAR3 DNA, complete sequence
ATGCAGCGATACACGGTCCCGGCGCATCTCGATGATCCCGAACTGATCGGCTTTTGGACTCTCGATGAGT
TCATCGCGATGATCGTGCCCTTCGCCTGGGGCGTCCTGTCTCAACATATTCTGATTGGGCTCTTAACAAG
CGTGCTGGCCTGGTGGGGATTGCGCAAGTTGAAGGCGGGACGCGCGGTCTCGTGGATCATCCACACGGCC
TACTGGTATCTGCCGGGCTCGTTCATGGGCCTCAAGGCAACGCCGCCCTCCCACCTTCGCGTGATGGCGG
GCTGA
 Primer design