SecReT4
Protein ID: 113473814
T4SS name [ID]Tra_F [517]
Gene symboltraF
Locus tagpCAR3_136
StrainSphingomonas sp. KA1 plasmid pCAR3 (NC_008308)
Repliconplasmid pCAR3 [GenBank: NC_008308] [Browse all T4SS(s) in this replicon]
Location [Strand]137653..138471 [+]
Productpilus assembly and synthesis protein
Component typeTraF_F
UniProt IDQ0KJH7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5e-68, Aligned region: 50..261
Protein Sequence: 272 a.a.     [Download]
>gi|113473814|ref|YP_718077.1| pilus assembly and synthesis protein [Sphingomonas sp. KA1]
MILRPRTSLTVLATLLAAPTTLALAADPHGDGVEVEQQEDALYCKERRLGTWFYCERPKEAPRAAASPAA
SARSQLAAISANLEELKARAILDPSAENVTAYVRFQREQLDRSSLFADVWQRALWQDPGLDYTLQRPVST
LGKRAWIDQRKTDRDLAMAKLPGRYGVFYFYASSCGACDIFAPILKAVSDRYGLAVLAVSMDGGPTATFP
NYVVDAGQYERLGLGTDRQVPALVLFDSVTKQPMPIGYGILSQDEIMDRVFQLTQVQPGSDF
 
Nucleotide Sequence: 819 bp     [Download]
>gi|113473678|ref|NC_008308.1|:137653-138471 Sphingomonas sp. KA1 plasmid pCAR3 DNA, complete sequence
ATGATCCTGCGTCCCCGAACCTCACTCACGGTGCTGGCCACACTTCTGGCAGCACCCACCACTTTGGCGC
TTGCGGCAGACCCGCACGGCGATGGCGTTGAAGTCGAGCAGCAGGAAGACGCGCTCTACTGCAAGGAGCG
CAGGCTCGGGACTTGGTTCTACTGCGAGCGGCCCAAAGAAGCGCCGCGCGCGGCGGCAAGCCCCGCGGCC
TCTGCGCGCAGCCAGCTTGCGGCGATCTCTGCCAATCTCGAAGAGCTGAAGGCGCGCGCCATCCTCGATC
CCAGCGCAGAGAACGTCACCGCCTATGTCCGCTTCCAGCGCGAGCAGCTCGACCGCTCCTCGCTGTTCGC
CGATGTCTGGCAGCGCGCTCTGTGGCAGGATCCGGGGCTCGACTACACGCTGCAGCGCCCGGTCTCGACG
CTCGGCAAGCGTGCCTGGATCGACCAGCGCAAGACCGATCGCGACCTTGCCATGGCGAAACTTCCCGGGC
GCTACGGGGTGTTCTACTTCTACGCCTCGAGCTGCGGCGCCTGCGATATCTTCGCCCCGATCCTCAAAGC
CGTGAGCGACAGGTACGGGCTTGCCGTCCTCGCGGTGTCAATGGACGGCGGCCCGACCGCGACCTTCCCG
AACTATGTCGTCGATGCCGGGCAGTACGAACGGCTCGGGCTCGGCACCGATCGCCAAGTGCCCGCGCTGG
TCCTGTTCGACTCCGTGACGAAGCAACCGATGCCGATCGGTTACGGGATCCTCAGCCAGGACGAGATTAT
GGACCGGGTGTTCCAGCTGACCCAGGTGCAGCCCGGGAGCGACTTCTGA
 Primer design