SecReT4
Protein ID: 113706770
T4SS name [ID]Trw [141]
Gene symboltraL
Locus tagpMUR050_032
StrainEscherichia coli plasmid pMUR050 (NC_007682)
Repliconplasmid pMUR050 [GenBank: NC_007682] [Browse all T4SS(s) in this replicon]
Location [Strand]29833..30567 [+]
Producthypothetical protein
Component typeTrwN
UniProt IDQ46694
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 6.7e-34, Aligned region: 31..176
Protein Sequence: 244 a.a.     [Download]
>gi|113706770|ref|YP_724489.1| hypothetical protein pMUR050_032 [Escherichia coli]
MSKHPKLLVLALACLACAGRASAAPASDEVARLAQRCAPDVSPLTMAYIVGHESSNGPYRININGSIQLK
QQPRTEAEAVSVAKVLLKDNKSFDMGLAQINSNNLVGLGLSVDDIFKPCINLRASQTILKACYDSALKSY
PAGQVALRHALSCYNTGSLTNGISNGYVTKVINVARQSTDLKIPTLLPDGQTSEDSTANEPQQAKSTAPQ
YDGEQDVFGSGDGDAFSRNNTDAFLTRQETAKGE
 
Nucleotide Sequence: 735 bp     [Download]
>gi|116536719|ref|NC_007682.3|:29833-30567 Escherichia coli plasmid pMUR050, complete sequence
ATGAGTAAACATCCAAAACTCCTGGTTCTCGCTCTGGCCTGCCTTGCTTGTGCTGGCCGTGCCAGTGCTG
CGCCTGCCTCCGATGAAGTTGCCAGGCTTGCGCAGAGATGTGCGCCTGATGTTTCACCCTTAACGATGGC
GTACATCGTCGGCCATGAGTCCTCAAATGGACCGTACAGGATCAATATTAACGGTAGTATTCAGTTAAAA
CAGCAACCGCGTACTGAAGCTGAGGCCGTCAGCGTTGCGAAAGTTCTGCTGAAGGATAATAAAAGTTTTG
ATATGGGCCTTGCACAAATTAACTCAAATAATTTAGTGGGCCTGGGTCTTTCGGTTGACGATATTTTCAA
ACCCTGCATCAACCTGCGGGCGAGCCAGACCATTCTTAAAGCCTGTTATGATAGCGCCCTGAAATCCTAC
CCAGCCGGGCAGGTTGCGCTGAGACACGCGCTTTCCTGCTACAACACCGGCTCACTCACAAACGGGATTT
CTAACGGGTATGTCACGAAAGTTATCAACGTGGCGCGTCAATCAACTGATTTGAAAATCCCTACGCTGCT
ACCTGACGGCCAGACCAGTGAGGACAGCACCGCGAATGAGCCTCAGCAGGCAAAAAGTACGGCGCCGCAG
TATGACGGTGAACAAGATGTTTTTGGTTCTGGTGATGGCGATGCCTTCAGCCGAAATAATACGGATGCCT
TTTTAACCAGACAGGAAACAGCGAAGGGGGAATGA
 Primer design