SecReT4
Protein ID: 113706772
T4SS name [ID]Trw [141]
Gene symboltraM
Locus tagpMUR050_034
StrainEscherichia coli plasmid pMUR050 (NC_007682)
Repliconplasmid pMUR050 [GenBank: NC_007682] [Browse all T4SS(s) in this replicon]
Location [Strand]30867..31160 [+]
Producthypothetical protein
Component typeTrwL
UniProt IDQ46696
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.3e-06, Aligned region: 11..91
Protein Sequence: 97 a.a.     [Download]
>gi|113706772|ref|YP_724491.1| hypothetical protein pMUR050_034 [Escherichia coli]
MTTLFKKYGPAVVMGVLSIALPQIALAAGTDTGESTATSIQTWLSTWIPIGCAIAIMVSCFMWMLHVIPA
SFIPRIVISLIGIGSASYLVSLTGVGS
 
Nucleotide Sequence: 294 bp     [Download]
>gi|116536719|ref|NC_007682.3|:30867-31160 Escherichia coli plasmid pMUR050, complete sequence
ATGACCACGTTGTTTAAGAAGTATGGCCCTGCGGTAGTTATGGGCGTTTTGTCCATTGCCCTGCCGCAAA
TTGCGCTGGCCGCTGGCACCGATACTGGTGAATCAACCGCTACATCAATCCAGACGTGGTTGAGCACATG
GATTCCAATTGGTTGTGCTATTGCGATCATGGTTAGTTGCTTTATGTGGATGCTTCACGTAATCCCAGCC
AGCTTTATTCCTCGTATCGTAATCTCTCTGATTGGTATTGGTTCTGCATCATATCTGGTTTCCCTGACGG
GCGTAGGAAGCTGA
 Primer design