SecReT4
Protein ID: 113706775
T4SS name [ID]Trw [141]
Gene symboltraC
Locus tagpMUR050_037
StrainEscherichia coli plasmid pMUR050 (NC_007682)
Repliconplasmid pMUR050 [GenBank: NC_007682] [Browse all T4SS(s) in this replicon]
Location [Strand]34144..34857 [+]
Producthypothetical protein
Component typeTrwJ
UniProt IDQ17U20
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 9.7e-45, Aligned region: 25..216
Protein Sequence: 237 a.a.     [Download]
>gi|113706775|ref|YP_724494.1| hypothetical protein pMUR050_037 [Escherichia coli]
MKKSLTAVLLTTGLILGGAQSASAGIIVSNPTELIKQGEQLEQMAQQLEQLKSQLETQKNMYESMAKTTN
LGDLLGTSTNTLANNLPDNWKEVYSDAMNSSSSVTPSVNSMMGQFNAEVDDMTPSEAIAYMNKKLDGKRC
LRPCDGRKAYNNQMQELSDMQALTEQIKSTPDLKSIADLQARIQTSQGAIQGEQAKLNLMNMLQQSQDKL
LRAQKDRATRNFVFGTGGDVTASPSIN
 
Nucleotide Sequence: 714 bp     [Download]
>gi|116536719|ref|NC_007682.3|:34144-34857 Escherichia coli plasmid pMUR050, complete sequence
ATGAAAAAATCACTTACGGCAGTGCTGCTGACCACCGGCTTGATTCTTGGGGGCGCGCAAAGCGCCTCCG
CTGGCATCATCGTATCCAACCCCACCGAGCTGATTAAACAGGGTGAACAGCTTGAACAAATGGCTCAACA
GCTGGAGCAGCTTAAAAGCCAGCTGGAGACGCAGAAAAATATGTATGAGTCGATGGCTAAAACAACCAAC
CTGGGCGATCTGCTGGGGACGTCAACCAATACGCTGGCGAATAACCTGCCTGACAACTGGAAAGAGGTGT
ACAGCGACGCGATGAACTCCAGTTCGTCGGTCACGCCTTCTGTTAACAGCATGATGGGCCAGTTTAATGC
TGAGGTTGACGACATGACGCCCAGCGAAGCAATCGCCTATATGAACAAAAAGCTGGACGGAAAAAGGTGC
TTACGACCGTGTGATGGCCGAAAAGCCTACAACAACCAGATGCAAGAGCTGAGCGATATGCAGGCGCTGA
CGGAGCAGATTAAATCGACGCCAGACCTGAAATCCATTGCCGACCTGCAAGCACGTATCCAGACGTCACA
AGGCGCTATACAGGGTGAGCAGGCGAAGCTGAATTTGATGAATATGTTACAGCAATCGCAGGACAAACTT
TTGCGCGCACAGAAGGATCGTGCGACCCGTAATTTTGTTTTTGGAACCGGTGGGGACGTTACCGCGTCAC
CTTCAATTAACTGA
 Primer design