SecReT4
Protein ID: 113706778
T4SS name [ID]Trw [141]
Gene symboltraN
Locus tagpMUR050_040
StrainEscherichia coli plasmid pMUR050 (NC_007682)
Repliconplasmid pMUR050 [GenBank: NC_007682] [Browse all T4SS(s) in this replicon]
Location [Strand]36231..36377 [+]
Producthypothetical protein
Component typeTrwH
UniProt IDQ17U17
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 48 a.a.     [Download]
>gi|113706778|ref|YP_724497.1| hypothetical protein pMUR050_040 [Escherichia coli]
MRSLLLMGVLLISACSSGHKPPPEPDWSNTVPVNKTIPVDTQGGANES
 
Nucleotide Sequence: 147 bp     [Download]
>gi|116536719|ref|NC_007682.3|:36231-36377 Escherichia coli plasmid pMUR050, complete sequence
ATGCGCAGCTTATTGCTTATGGGAGTTCTTCTGATTAGCGCCTGTTCCAGCGGGCATAAACCGCCACCGG
AGCCGGACTGGAGCAACACCGTTCCAGTAAACAAAACAATCCCGGTTGATACGCAAGGTGGTGCAAATGA
AAGCTAA
 Primer design