SecReT4
Protein ID: 113706779
T4SS name [ID]Trw [141]
Gene symboltraE
Locus tagpMUR050_041
StrainEscherichia coli plasmid pMUR050 (NC_007682)
Repliconplasmid pMUR050 [GenBank: NC_007682] [Browse all T4SS(s) in this replicon]
Location [Strand]36367..37065 [+]
Producthypothetical protein
Component typeTrwG
UniProt IDQ17U16
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9e-53, Aligned region: 24..230
Protein Sequence: 232 a.a.     [Download]
>gi|113706779|ref|YP_724498.1| hypothetical protein pMUR050_041 [Escherichia coli]
MKANKKTGLTREAIKEFNESRKGLEVDLMDEVLKSRRTAWMVATGSAVVTVFALSLVGYVVHKYSQPIPA
HLLTLNEATHEVQQVKLTRDQTSYGDEIDKFWLTQYVIHRESYDFYSVQVDYTAVGLMSTPNVAESYQSK
FKGRNGLDKVLGDSETTRVKINSVILDKPHGVATIRFTTVRRVRSNPVDDQPQRWIAIMGYEYKSLAMNA
EQRYVNPLGFRVTSYRVNPEVN
 
Nucleotide Sequence: 699 bp     [Download]
>gi|116536719|ref|NC_007682.3|:36367-37065 Escherichia coli plasmid pMUR050, complete sequence
ATGAAAGCTAATAAAAAAACAGGGCTTACACGTGAAGCCATTAAAGAGTTCAACGAAAGCCGTAAAGGGC
TTGAAGTTGATCTGATGGATGAAGTGCTGAAGTCCCGGCGTACCGCCTGGATGGTTGCCACCGGTTCAGC
GGTGGTAACTGTTTTTGCACTCTCTTTAGTTGGTTACGTAGTGCATAAGTACAGCCAGCCAATCCCCGCA
CATCTGCTAACGCTCAACGAGGCCACTCACGAAGTACAGCAGGTCAAGCTGACCCGCGACCAGACCTCTT
ATGGTGACGAAATTGATAAGTTCTGGCTGACACAATATGTCATTCACCGTGAGAGCTATGACTTCTATTC
AGTTCAGGTCGACTATACGGCCGTTGGCTTAATGTCCACGCCGAACGTGGCAGAGTCTTACCAGAGCAAG
TTCAAGGGCCGCAATGGTCTTGATAAGGTTCTGGGCGACAGTGAAACGACCCGCGTGAAGATTAACTCTG
TGATCCTCGATAAACCGCACGGCGTAGCAACAATACGCTTTACTACGGTTCGCCGCGTGCGCAGCAATCC
CGTTGATGATCAGCCGCAGCGCTGGATTGCCATTATGGGGTATGAATATAAATCGCTGGCGATGAATGCT
GAGCAGCGTTATGTCAACCCGCTGGGTTTCCGCGTGACGAGTTATCGCGTCAACCCGGAAGTTAACTGA
 Primer design