SecReT4
Protein ID: 114326563
T4SS name [ID]Trb [236]
Gene symbol-
Locus tagNeut_2541
StrainNitrosomonas eutropha C91
Repliconplasmid Plasmid1 [GenBank: NC_008341] [Browse all T4SS(s) in this replicon]
Location [Strand]8758..9339 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDQ0AD27
KEGG IDnet:Neut_2541
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.4e-35, Aligned region: 46..189
Protein Sequence: 193 a.a.     [Download]
>gi|114326563|ref|YP_743722.1| conjugal transfer protein TrbG/VirB9/CagX [Nitrosomonas eutropha C91]
MKCKPKLINASSFADSVSMNSFSFAVIVSQKMRQMRAEPVSNASYYTYTIKLASTKNDWMPILSFDYPDD
IQREWAAYHLRKTQVVQTNTMPATGQNLAALDFNYNLSGDNPSWKPVRIYTDGIKTYIQFPSTHFNESPA
LLSLGNSGDEELVNYRLIGDRYVVDKVLDRAALIVGVGLSQTKVEIIRKEGSK
 
Nucleotide Sequence: 582 bp     [Download]
>gi|114326555|ref|NC_008341.1|:c9339-8758 Nitrosomonas eutropha C91 plasmid1, complete sequence
ATGAAATGCAAGCCGAAGCTGATAAATGCGAGCTCATTTGCAGATAGCGTGAGCATGAACAGCTTTTCAT
TTGCAGTTATTGTGAGCCAGAAAATGCGTCAAATGCGAGCAGAGCCAGTTTCAAACGCGAGCTATTACAC
CTATACGATCAAGTTAGCCAGTACAAAAAATGACTGGATGCCAATACTATCTTTTGATTACCCCGATGAT
ATTCAAAGAGAGTGGGCTGCTTATCATCTGCGTAAAACACAGGTTGTTCAAACGAACACAATGCCTGCGA
CCGGCCAGAATCTTGCTGCCCTTGATTTTAACTATAACCTGAGTGGTGACAATCCATCATGGAAGCCCGT
TCGTATTTATACGGATGGCATTAAAACTTATATCCAGTTTCCGTCAACACATTTCAACGAATCTCCTGCA
TTACTGTCACTCGGTAATTCTGGCGATGAAGAGCTGGTTAACTACCGTCTGATTGGGGATCGCTATGTAG
TAGACAAGGTACTGGATCGCGCGGCTCTTATTGTTGGTGTCGGATTGTCACAAACCAAAGTCGAAATTAT
CCGTAAAGAGGGCAGCAAATGA
 Primer design